Tested Applications
| Positive WB detected in | mouse lung tissue, rat lung tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14300-1-AP targets SULT1C4 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5259 Product name: Recombinant human SULT1C4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC058861 Sequence: MALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQNEGDVEKSKRAPTHQRFPFLEMKIPSLGSGEYK Predict reactive species |
| Full Name | sulfotransferase family, cytosolic, 1C, member 4 |
| Calculated Molecular Weight | 36 kDa |
| Observed Molecular Weight | 35 kDa |
| GenBank Accession Number | BC058861 |
| Gene Symbol | SULT1C4 |
| Gene ID (NCBI) | 27233 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O75897 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SULT1C4 (Sulfotransferase 1C4), a member of a gene subfamily that includes three human members, SULT1C2, 1C3, and 1C4, is a dimeric Phase II drug-metabolizing enzyme primarily expressed in the developing fetus. SULT1C4 transcript is expressed in human intestinal and hepatic cell lines as well as in human liver specimens from different developmental stages, while SULT1C4 protein is barely detectable (PMID: 28222028, 32303576).



