Serpin A4/Kallistatin Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of human plasma using 86758-3-RR (same clone as 86758-3-PBS)

  Human plasma was subjected to SDS PAGE followed by western blot with 86758-3-RR (Serpin A4/Kallistatin antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86758-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86758-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86758-3-RR against Human Serpin A4/Kallistatin were performed. The affinity constant is 0.215 nM.

Serpin A4/Kallistatin Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86758-3-PBS

Clone No.251716C12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Kallistatin, Serpin A4, KAL, Kallikrein inhibitor, KLST

---

Product Information

86758-3-PBS targets Serpin A4/Kallistatin in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4707

  Product name: Recombinant Human Serpin A4/Kallistatin protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 21-427 aa of NM_001289033.1

  Sequence: QLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASETPGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHRGFQHLLHTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQEHHWYLHDRYLPCSVLRMDYKGDATVFFILPNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSGITKQQKLEASKSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLFLGKVVDPTKP

• Full Name: serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 4
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: NM_001289033.1
• Gene Symbol: Kallistatin
• Gene ID (NCBI): 5267
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P29622
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Serpin A4 is also named Kallistatin and Peptidase inhibitor 4 (PI-4). Kallistatin was first identified in human plasma as a tissue kallikrein-binding protein and a serine proteinase inhibitor. Kallistatin via its two structural elements regulates differential signaling cascades, and thus a wide spectrum of biological functions (PMID: 28427524). Kallistatin via the active site promotes neovascularization by stimulating VEGF levels in endothelial progenitor cells. Second, kallistatin inhibits or induces apoptosis depending on cell types. Kallistatin via its heparin-binding site inhibits angiogenesis by blocking vascular endothelial growth factor (VEGF)-induced growth, migration and adhesion of endothelial cells. Kallistatin can act as an antioxidant or pro-oxidant (PMID: 28742513).