Spexin Polyclonal antibody

• 

  IHC staining of mouse heart using 20467-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 20467-1-AP (C12orf39 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 20467-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 20467-1-AP (C12orf39 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 20467-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 20467-1-AP (Spexin antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 20467-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 20467-1-AP (Spexin antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse heart using 20467-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse heart tissue using C12orf39 antibody (20467-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse liver using 20467-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse liver tissue using Spexin antibody (20467-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Spexin Polyclonal Antibody for IHC, IF-P, ELISA

Cat No. 20467-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF-P, ELISA

Synonyms

C12orf39, Neuropeptide Q, Spexin hormone, Spexin-1, Spexin-2

---

Tested Applications

• Positive IHC detected in: human kidney tissue, mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse heart tissue, mouse liver tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20467-1-AP targets Spexin in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14304

  Product name: Recombinant human C12orf39 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-116 aa of BC004336

  Sequence: MKGLRSLAATTLALFLVFVFLGNSSCAPQRLLERRNWTPQAMLYLKGAQGRRFISDQSRRKDLSDRPLPERRSPNPQLLTIPEAATILLASLQKSPEDEEKNFDQTRFLEDSLLNW

• Full Name: chromosome 12 open reading frame 39
• Calculated Molecular Weight: 116 aa, 13 kDa
• GenBank Accession Number: BC004336
• Gene Symbol: C12orf39
• Gene ID (NCBI): 80763
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BT56
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Spexin (SPX), also known as neuropeptide Q, is a novel and highly conserved neuroendocrine peptide discovered through bioinformatics. Spexin and its receptors (primarily galanin receptor types 2 and 3) are widely expressed throughout the body, including the central nervous system, gastrointestinal tract, adipose tissue, kidneys, and cardiovascular system. Research indicates that Spexin is a multifunctional regulatory peptide, with its most central role being in energy homeostasis and metabolic regulation. It functions to suppress appetite, reduce body weight, and improve insulin resistance and glucose metabolism, making it a potential biomarker and therapeutic target for metabolic diseases such as obesity and type 2 diabetes. Additionally, Spexin is involved in regulating various physiological and pathological processes, including pain perception, anxiety- and depression-like behaviors, cardiovascular function, and reproductive activities.