Surfactant protein D Polyclonal antibody, PBS Only

• 

  WB analysis using 11839-1-AP (same clone as 11839-1-PBS)

  Mouse lung tissue was subjected to SDS PAGE followed by western blot with 11839-1-AP (Surfactant protein D antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11839-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse lung using 11839-1-AP (same clone as 11839-1-PBS)

  IP result of anti-Surfactant protein D (IP:11839-1-AP, 3ug; Detection:11839-1-AP 1:300) with mouse lung tissue lysate 2800ug. This data was developed using the same antibody clone with 11839-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 11839-1-AP (same clone as 11839-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 11839-1-AP (Surfactant protein D antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11839-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 11839-1-AP (same clone as 11839-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 11839-1-AP (Surfactant protein D antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11839-1-PBS in a different storage buffer formulation.

Surfactant protein D Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 11839-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

11839-1-PBS targets Surfactant protein D in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2461

  Product name: Recombinant human SFTPD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-375 aa of BC022318

  Sequence: AGMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGKPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF

• Full Name: surfactant protein D
• Calculated Molecular Weight: 375 aa, 38 kDa
• Observed Molecular Weight: 37-40 kDa
• GenBank Accession Number: BC022318
• Gene Symbol: Surfactant protein D
• Gene ID (NCBI): 6441
• RRID: AB_2254351
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35247
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Surfactant protein-D (SP-D) is a pattern recognition molecule of the collectin family of C-type lectins, which consist of four structural domains: a cysteine-rich N-terminal domain, a collagen-like region, an alpha-helical coiled-coil neck domain and a C-terminal lectin or carbohydrate-recognition domain (PMID: 16213021; 15030473). SP-D is primarily expressed and secreted by type II alveolar cells (PMID: 16684127). It plays a central role in the pulmonary host defence and the modulation of allergic responses.