Synaptotagmin-10 Polyclonal antibody, PBS Only

• 

  WB analysis using 20881-1-AP (same clone as 20881-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20881-1-AP (SYT10 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20881-1-PBS in a different storage buffer formulation.

Synaptotagmin-10 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 20881-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

SytX, SYT10, Synaptotagmin X

---

Product Information

20881-1-PBS targets Synaptotagmin-10 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15018

  Product name: Recombinant human SYT10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-53 aa of BC101024

  Sequence: MSFHKEDGVNSLCQKALHIVTELCFAGQVEWEKCSGIFPRDRGSQGGSSTDIS

• Full Name: synaptotagmin X
• Calculated Molecular Weight: 523 aa, 59 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC101024
• Gene Symbol: Synaptotagmin-10
• Gene ID (NCBI): 341359
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6XYQ8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis (PMID: 8058779). SYT10 (synaptotagmin-10) functions as a Ca2+ sensor to trigger IGF-1 exocytosis in neurons. Loss of Syt10 impairs activity-dependent IGF-1 secretion in olfactory bulb neurons and results in smaller neurons and an overall reduction in the number of synapses (PMID: 21496647).