Synaptotagmin-3 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse thymus using 12726-1-AP (same clone as 12726-1-PBS)

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 12726-1-AP (Synaptotagmin-3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12726-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 12726-1-AP (same clone as 12726-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12726-1-AP (Synaptotagmin-3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12726-1-PBS in a different storage buffer formulation.

Synaptotagmin-3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 12726-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

12726-1-PBS targets Synaptotagmin-3 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3425

  Product name: Recombinant human SYT3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 241-590 aa of BC028379

  Sequence: QPDPSSEERPPALPLPLPGGEEKAKLIGQIKPELYQGTGPGGRRSGGGPGSGEAGTGAPCGRISFALRYLYGSDQLVVRILQAMDLPAKDSNGFSDPYVKIYLLPDRKKKFQTKVHRKTLNPVFNETFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVVLDNLLELAEQPPDRPLWRDIVEGGSEKADLGELNFSLCYLPTAGRLTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAVVDYDCIGHNEVIGVCRVGPDAADPHGREHWAEMLANPRKPVEHWHQLVEEKTVTSFTKGSKGLSEKENSE

• Full Name: synaptotagmin III
• Calculated Molecular Weight: 590 aa, 63 kDa
• Observed Molecular Weight: 63 kDa
• GenBank Accession Number: BC028379
• Gene Symbol: Synaptotagmin-3
• Gene ID (NCBI): 84258
• RRID: AB_2271429
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BQG1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.