TAB1 Polyclonal antibody

• 

  WB analysis using 27566-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27566-1-AP (TAB1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27566-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27566-1-AP (TAB1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 27566-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 27566-1-AP (TAB1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 27566-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 27566-1-AP (TAB1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 27566-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 27566-1-AP (TAB1 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human liver using 27566-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 27566-1-AP (TAB1 antibody) at dilution of 1:200 (under 40x lens).

• Featured Product
• KD/KO Validated

TAB1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27566-1-AP

Publications(3)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, IP, ELISA

Synonyms

MAP3K7IP1, Mitogen-activated protein kinase kinase kinase 7-interacting protein 1, TAK1 binding protein 1, TAK1-binding protein 1, TGF-beta-activated kinase 1 and MAP3K7-binding protein 1

---

Tested Applications

• Positive WB detected in: A375 cells, HEK-293T cells, NIH/3T3 cells, HCT 116 cells, HeLa cells, K-562 cells
• Positive IHC detected in: human colon cancer tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 3 publications below
• IF: See 1 publications below
• IP: See 1 publications below

Product Information

27566-1-AP targets TAB1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25576

  Product name: Recombinant human MAP3K7IP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 400-504 aa of BC050554

  Sequence: TSKTSVTLSLVMPSQGQMVNGAHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEPYVDFAEFYRLWSVDHGEQSVVTAP

• Full Name: mitogen-activated protein kinase kinase kinase 7 interacting protein 1
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC050554
• Gene Symbol: TAB1
• Gene ID (NCBI): 10454
• RRID: AB_2880910
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15750
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 (TAB1) is also named TAK1-binding protein 1 and MAP3K7IP1. TAB1 is constitutively associated with the composition N-terminal kinase domain of TAK1 and can be activated by pro-inflammatory cytokines (TNFα and IL-1β) and toll-like receptor ligands (PMID: 38072991). TAB1 is a scaffolding protein required for TGF-β activated kinase-1 (TAK1) mediated signalling. TAB1 is a specific protein that interacts with transforming growth factor β-activated kinase 1 (TAK1) (PMID: 32676538). TAB1/TAK1 can activate nuclear factor κB (NF-κB) in high glucose (HG)-induced BMMs, regulating macrophage activation (PMID: 32296020, PMID: 23851980).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IP	Blood; Platelet NLRP6 protects against microvascular thrombosis in sepsis; Authors - Huimin Jiang
human	WB	Theranostics; Virus-induced p38 MAPK activation facilitates viral infection.; Authors - Yuting Cheng ; KO Validated
human	WB,IF	Int J Mol Sci; MicroRNA-27a-5p Downregulates Expression of Proinflammatory Cytokines in Lipopolysaccharide-Stimulated Human Dental Pulp Cells via the NF-κB Signaling Pathway; Authors - Shihan Wang ; KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

MALLIKARJUNA (Verified Customer) (11-26-2025)

works well for wb and IHC

• Applications: Western Blot, Immunohistochemistry
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: liver tissue