transgelin/SM22 Polyclonal antibody

• 

  WB analysis using 10493-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10493-1-AP (transgelin/SM22 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 10493-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10493-1-AP (transgelin/SM22 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse heart using 10493-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 10493-1-AP (transgelin/SM22 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 10493-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 10493-1-AP (transgelin/SM22 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 10493-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10493-1-AP (transgelin/SM22 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 10493-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10493-1-AP (transgelin/SM22 antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 10493-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10493-1-AP (transgelin/SM22 antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse heart using 10493-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using transgelin/SM22 antibody (10493-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of mouse heart using 10493-1-AP

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse heart tissue using 10493-1-AP (transgelin/SM22 antibody) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

transgelin/SM22 Polyclonal Antibody for WB, IHC, IF-P, IF-Fro, ELISA

Cat No. 10493-1-AP

Publications(156)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF-P, IF-Fro, IP, ELISA

Synonyms

SM22, transgelin, 22 kDa actin-binding protein, Protein WS3-10, SM22-a

---

Tested Applications

• Positive WB detected in: mouse colon tissue, mouse stomach tissue, rat colon tissue, rat stomach tissue
• Positive IHC detected in: mouse heart tissue, human colon cancer tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse heart tissue
• Positive IF-Fro detected in: mouse heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:20000-1:100000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800
• Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 110 publications below
• IHC: See 22 publications below
• IF: See 49 publications below
• IP: See 1 publications below

Product Information

10493-1-AP targets transgelin/SM22 in WB, IHC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, canine, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0764

  Product name: Recombinant human TAGLN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-201 aa of BC004927

  Sequence: MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS

• Full Name: transgelin
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 19-22 kDa
• GenBank Accession Number: BC004927
• Gene Symbol: transgelin/SM22
• Gene ID (NCBI): 6876
• RRID: AB_2199363
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q01995
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The transgelin family is a protein group belonging to the 22kd actin-related calponin superfamily. Of all three isoforms, transgelin 1 is the best characterized. Transgelin 1, or SM22alpha, is a specific marker for differentiated smooth muscle cells. Transgelin 2, also known as SM22 beta, is expressed by both smooth and non-smooth muscle cells in a temporally and spatially regulated pattern. Trangenlin 3, also known as NP25, is only found in highly differentiated neuronal cells. This antibody was generated against full-length transgelin 1 protein. It can cross-react with other two transgenes based on the sequence similarity.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Cell; Mapping the Fine-Scale Organization and Plasticity of the Brain Vasculature.; Authors - Christoph Kirst
mouse	WB,IF	Cell Host Microbe; Gut microbiome dysbiosis contributes to abdominal aortic aneurysm by promoting neutrophil extracellular trap formation; Authors - Zhenyu Tian
mouse	IF	Acta Pharm Sin B; The substitution of SERCA2 redox cysteine 674 promotes pulmonary vascular remodeling by activating IRE1α/XBP1s pathway.; Authors - Weimin Yu
mouse	IHC	J Exp Med; Dependence of proliferative vascular smooth muscle cells on CD98hc (4F2hc, SLC3A2).; Authors - Fogelstrand Per P
mouse	IF	Nat Commun; Hyperlipidemia-induced cholesterol crystal production by endothelial cells promotes atherogenesis.; Authors - Yvonne Baumer
mouse	IF	Circ Res; Peptide-mediated disruption of calmodulin-cyclin E interactions inhibits proliferation of vascular smooth muscle cells and neointima formation.; Authors - Hui Sonya S

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Ying (Verified Customer) (08-19-2019)

very good antibody

• Applications: Western Blot,
• Primary Antibody Dilution: 1000
• Cell Tissue Type: primary mouse cardiomyocytes