CoraLite® Plus 488-conjugated transgelin/SM22 Polyclonal antibody

• 

  IF Staining of mouse heart using CL488-10493

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse heart tissue using CoraLite® Plus 488 transgelin/SM22 antibody (CL488-10493) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

transgelin/SM22 Polyclonal Antibody for IF-P

Cat No. CL488-10493

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

Synonyms

SM22, transgelin, Smooth muscle protein 22-alpha, SM22-alpha, SM22-a

---

Tested Applications

• Positive IF-P detected in: mouse heart tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10493 targets transgelin/SM22 in IF-P applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0764

  Product name: Recombinant human TAGLN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-201 aa of BC004927

  Sequence: MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS

• Full Name: transgelin
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 19-22 kDa
• GenBank Accession Number: BC004927
• Gene Symbol: transgelin/SM22
• Gene ID (NCBI): 6876
• RRID: AB_2918981
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q01995
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

The transgelin family is a group of proteins that belong to 22kd actin-related calponin superfamily. Of all three isoforms, transgelin 1 is the best characterized. Transgelin 1, also known as SM22alpha, is a specific marker for differentiated smooth muscle cells. Transgelin 2, also known as SM22 beta, is expressed by both smooth muscle and non-smooth muscle cells in a temporally and spatially regulated pattern. Trangenlin 3, also known as NP25, is only found in highly differentiated neuronal cells. This antibody was generated against full length transgelin 1 protein. It can cross-react with other two transgelins based on the sequence similarity.