• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated transgelin/SM22 Polyclonal antibody

transgelin/SM22 Polyclonal Antibody for IF-P

Cat No. CL594-10493

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

22 kDa actin binding protein, DKFZp686P11128, Protein WS3 10, SM22, SM22 alpha, SM22alpha, SMCC, Smooth muscle protein 22 alpha, TAGLN, TAGLN1, transgelin, TRANSGELIN 1, WS3 10

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse heart tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-10493 targets transgelin/SM22 in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0764

Product name: Recombinant human TAGLN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-201 aa of BC004927

Sequence: MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS

Predict reactive species
Full Name transgelin
Calculated Molecular Weight 22 kDa
Observed Molecular Weight 19-22 kDa
GenBank Accession NumberBC004927
Gene Symbol transgelin/SM22
Gene ID (NCBI) 6876
RRIDAB_2919735
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ01995
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The transgelin family is a group of proteins that belong to 22kd actin-related calponin superfamily. Of all three isoforms, transgelin 1 is the best characterized. Transgelin 1, also known as SM22alpha, is a specific marker for differentiated smooth muscle cells. Transgelin 2, also known as SM22 beta, is expressed by both smooth muscle and non-smooth muscle cells in a temporally and spatially regulated pattern. Trangenlin 3, also known as NP25, is only found in highly differentiated neuronal cells. This antibody was generated against full length transgelin 1 protein. It can cross-react with other two transgelins based on the sequence similarity.

Protocols

Product Specific Protocols
IF protocol for CL594 transgelin/SM22 antibody CL594-10493Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...