TAPBP Polyclonal antibody

• 

  WB analysis using 30500-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30500-1-AP (TAPBP antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse colon using 30500-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 30500-1-AP (TAPBP antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse colon using 30500-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 30500-1-AP (TAPBP antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 30500-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using TAPBP antibody (30500-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

TAPBP Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 30500-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

NGS 17, NGS17, TAP associated protein, TAP binding protein, TAP binding protein (tapasin), TAPA, tapasin, TAPBP, TPN, TPSN

---

Tested Applications

• Positive WB detected in: HeLa cells, MDA-MB-231 cells, THP-1 cells
• Positive IHC detected in: mouse colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:400-1:1600
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30500-1-AP targets TAPBP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30885

  Product name: Recombinant human TAPBP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-120 aa of NM_003190

  Sequence: GPAVIECWFVEDASGKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPRGAPAPHCEMSRFVPLPASAKWASGLTPAQNCPRALD

• Full Name: TAP binding protein (tapasin)
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: NM_003190
• Gene Symbol: TAPBP
• Gene ID (NCBI): 6892
• RRID: AB_3086339
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15533
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TAPBP, also known as tapasin, is a V-C1 (variable-constant) immunoglobulin superfamily (IgSF) molecule. It is involved in the association of MHC class I with transporter associated with antigen processing (TAP) and in the assembly of MHC class I with peptide (PMID: 11920573).