TAPBP Polyclonal antibody, PBS Only

• 

  WB analysis using 30500-1-AP (same clone as 30500-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30500-1-AP (TAPBP antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30500-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 30500-1-AP (same clone as 30500-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 30500-1-AP (TAPBP antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30500-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 30500-1-AP (same clone as 30500-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 30500-1-AP (TAPBP antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30500-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 30500-1-AP (same clone as 30500-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using TAPBP antibody (30500-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 30500-1-PBS in a different storage buffer formulation.

TAPBP Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 30500-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

30500-1-PBS targets TAPBP in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30885

  Product name: Recombinant human TAPBP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-120 aa of NM_003190

  Sequence: GPAVIECWFVEDASGKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPRGAPAPHCEMSRFVPLPASAKWASGLTPAQNCPRALD

• Full Name: TAP binding protein (tapasin)
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: NM_003190
• Gene Symbol: TAPBP
• Gene ID (NCBI): 6892
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15533
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TAPBP, also known as tapasin, is a V-C1 (variable-constant) immunoglobulin superfamily (IgSF) molecule. It is involved in the association of MHC class I with transporter associated with antigen processing (TAP) and in the assembly of MHC class I with peptide (PMID: 11920573).