TBCB Polyclonal antibody, PBS Only

• 

  WB analysis using 15782-1-AP (same clone as 15782-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15782-1-AP (TBCB antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15782-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 15782-1-AP (same clone as 15782-1-PBS)

  IP result of anti-TBCB (IP:15782-1-AP, 3ug; Detection:15782-1-AP 1:500) with HeLa cells lysate 1200ug. This data was developed using the same antibody clone with 15782-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 15782-1-AP (same clone as 15782-1-PBS)

  Immunofluorescent analysis of Hela cells, using TBCB antibody 15782-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 15782-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 15782-1-AP (same clone as 15782-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using TBCB antibody (15782-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 15782-1-PBS in a different storage buffer formulation.

TBCB Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 15782-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

15782-1-PBS targets TBCB in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8473

  Product name: Recombinant human TBCB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-244 aa of BC005969

  Sequence: MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI

• Full Name: tubulin folding cofactor B
• Calculated Molecular Weight: 244 aa, 27 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC005969
• Gene Symbol: TBCB
• Gene ID (NCBI): 1155
• RRID: AB_2302986
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99426
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.