TBL3 Polyclonal antibody

• 

  WB analysis using 31150-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31150-1-AP (TBL3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A431 using 31150-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using TBL3 antibody (31150-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

• 

  IF Staining of HeLa using 31150-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using TBL3 antibody (31150-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

TBL3 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 31150-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

SAZD, TBL3, transducin (beta) like 3, Transducin beta like protein 3

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HeLa cells, Jurkat cells, mouse testis tissue
• Positive IF/ICC detected in: A431 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31150-1-AP targets TBL3 in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34900

  Product name: Recombinant human TBL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 591-720 aa of BC010231

  Sequence: TIKNNECVRTLDAHEDKVWGLHCSRLDDHALTGASDSRVILWKDVTEAEQAEEQARQEEQVVRQQELDNLLHEKRYLRALGLAISLDRPHTVLTVIQAIRRDPEACEKLEATMLRLRRDQKEALLRFCVT

• Full Name: transducin (beta)-like 3
• Calculated Molecular Weight: 89 kDa
• Observed Molecular Weight: 89 kDa
• GenBank Accession Number: BC010231
• Gene Symbol: TBL3
• Gene ID (NCBI): 10607
• RRID: AB_3669872
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q12788
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Transducin (beta)-like 3 (TBL3) is a protein of 808 amino acids with an apparent molecular weight of 89 kilodaltons.In mice, Tbl3 is a newly recognized nucleolar protein with regulatory roles in ribosome biogenesis (doi: 10.5315/wjh.v3.i3.93). In zebrafish, Tbl3 plays a tissue-specific role in regulating cell cycle rate during development(PMID: 22659140).