TCB1 Polyclonal antibody

• 

  WB analysis using 32193-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32193-1-AP (TCB1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse spleen using 32193-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 32193-1-AP (TCB1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 32193-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 32193-1-AP (TCB1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat spleen using 32193-1-AP

  Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 32193-1-AP (TCB1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat spleen using 32193-1-AP

  Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 32193-1-AP (TCB1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TCB1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 32193-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, ELISA

Synonyms

T-cell receptor beta-1 chain C region

---

Tested Applications

• Positive WB detected in: EL-4 cells, mouse thymus tissue, rat spleen tissue
• Positive IHC detected in: rat spleen tissue, mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32193-1-AP targets TCB1 in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg2437

  Product name: Recombinant Mouse TCB1 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 1-140 aa of

  Sequence: EDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLS

• Full Name: TCB1
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 40 kDa
• RRID: AB_3670219
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P01852
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.