TCERG1L Polyclonal antibody, PBS Only

• 

  IHC staining of mouse testis using 20858-1-AP (same clone as 20858-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 20858-1-AP (TCERG1L antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20858-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 20858-1-AP (same clone as 20858-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 20858-1-AP (TCERG1L antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20858-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse testis using 20858-1-AP (same clone as 20858-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using TCERG1L antibody (20858-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 20858-1-PBS in a different storage buffer formulation.

TCERG1L Polyclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 20858-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF-P, Indirect ELISA

Synonyms

---

Product Information

20858-1-PBS targets TCERG1L in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14828

  Product name: Recombinant human TCERG1L protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 337-545 aa of BC042951

  Sequence: DLNRIIEDPPHKRKLEAPATDNSDGSSSEDNREDQDVKTKRNRTEGCGSPKPEEAKREDKGTRTPPPQILLPLEERVTHFRDMLLERGVSAFSTWEKELHKIVFDPRYLLLNSEERKQIFEQFVKTRIKEEYKEKKSKLLLAKEEFKKLLEKSKVSPRTTFKEFAEKYGRDQRFRLVQKRKDQEHFFNKFILILKKRDKENRLRLRKMR

• Full Name: transcription elongation regulator 1-like
• Calculated Molecular Weight: 586 aa, 66 kDa
• GenBank Accession Number: BC042951
• Gene Symbol: TCERG1L
• Gene ID (NCBI): 256536
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5VWI1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TCERG1L, Transcription elongation regulator 1-like protein, is associated with plasma adiponectin, and plasma adiponectin is a key modulator of obesity, inflammation, IR and diabetes (PMID:22791750). Gene silencing of FBN2 and TCERG1L is associated with promoter DNA hypermethylation in CRC tumors and may be biomarkers for the early detection of CRC (PMID:22238052). Stra8 and TCERG1L play a role in retinoic acid induced spermatogonial differentiation in mouse (PMID:3395975).