TCIRG1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TCIRG1 Polyclonal antibody (12649-1-AP)

• Featured Product
• KD/KO Validated

TCIRG1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 12649-1-AP Copied!

Publications (14)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

ATP6N1C, ATP6V0A3, OC116, OC-116 kDa, OPTB1

• 

  WB analysis using 12649-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12649-1-AP (TCIRG1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 12649-1-AP

  WB result of TCIRG1 antibody (12649-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-TCIRG1 transfected A431 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of U-937 using 12649-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 12649-1-AP (TCIRG1 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 12649-1-AP

  Immunohistochemical analysis of paraffin-embedded human normal stomach slide using 12649-1-AP (TCIRG1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 12649-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using TCIRG1 antibody (12649-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 12649-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using TCIRG1 antibody (12649-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TCIRG1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HL-60 cells, U-937 cells, A431 cells, HuH-7 cells, SKOV-3 cells
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12649-1-AP targets TCIRG1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3378

  Product name: Recombinant human TCIRG1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-395 aa of BC018133

  Sequence: CVSRLGELGLVEFRDLNASVSAFQRRFVVDVRRCEELEKTFTFLQEEVRRAGLVLPPPKGRLPAPPPRDLLRIQEETERLAQELRDVRGNQQALRAQLHQLQLHAAVLRQGHEPQLAAAHTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAPALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFLISYWGEQIGQKIRKITDCFHCHVFPFLQQEEARLGALQQLQQQSQELQEVLGETERFLSQVLGRVLQLLPPGQVQVHKMKAVYLALNQCSVSTTHKCLIAEAWCSVRDLPALQEALRDSSMEEGVSAVAHRIPCRDMPPTLIRTNRFTASFQGIVDAYGVGRYQEVNPAPYTIIT

• Full Name: T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3
• Calculated Molecular Weight: 830 aa, 93 kDa
• Observed Molecular Weight: 92 kDa, 65-70 kDa
• GenBank Accession Number: BC018133
• Gene Symbol: TCIRG1
• Gene ID (NCBI): 10312
• RRID: AB_10644329
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13488
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TCIRG1, also known as V ATPase 116 kDa isoform a3, TIRC7, OPTB1, belongs to the V-ATPase 116 kDa subunit family, TCIRG1 seems to be directly involved in T-cell activation (PubMed:10329006). Alternative splicing results in multiple transcript variants. Isoform long is highly expressed in osteoclastomas. Isoform short is highly expressed in thymus (PMID: 15809087, 24753205). Mutations in TCIRG1 are associated with Osteopetrosis, autosomal recessive 1 (OPTB1)( PMID: 11532986).

Publications

What published studies show

The TCIRG1 Polyclonal antibody (Cat# 12649-1-AP) has 14 citations. They appear in journals including Cancer Cell International, Frontiers in Immunology, Biochemical Pharmacology, Frontiers in Microbiology, mBio, Oncotarget, Frontiers in Cell and Developmental Biology, Cancers, Oncology Reports, BMC Cancer, Journal of Virology, BMC Oral Health, Cancer Medicine, and Cancer Immunology Research. Research fields span renal cell carcinoma, esophageal cancer, osteoarthritis, osteoclast biology, viral egress, graft-versus-host disease, breast cancer, ovarian cancer, and lysosomal acidification.

Automatically generated from the 14 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Cell Int; Glycolysis-related biomarker TCIRG1 participates in regulation of renal cell carcinoma progression and tumor immune microenvironment by affecting aerobic glycolysis and AKT/mTOR signaling pathway; Authors - Sichen Di
human	IHC,IF	Front Immunol; Neoadjuvant immunochemotherapy improves clinical outcomes of patients with esophageal cancer by mediating anti-tumor immunity of CD8+ T (Tc1) and CD16+ NK cells; Authors - Yunlong He
human,mouse	WB,IHC	Biochem Pharmacol; The V-ATPase a3 subunit deficiency affects osteoarthritis via mTOR-Mediated autophagy levels in subchondral bone; Authors - Jianxin Qiu ; KD Validated
pig	WB	Front Microbiol; Lactobacillus gasseri LA39 Activates the Oxidative Phosphorylation Pathway in Porcine Intestinal Epithelial Cells.; Authors - Jun Hu
mouse	WB,IF	mBio; Progranulin-driven lysosomal acidification facilitates exocytosis of PHEV-hijacked lysosomes for viral release.; Authors - Zhenzhen Wang
human	IHC	Oncotarget; PMID: 28978047; Authors - Enrica Balza