TCIRG1 Polyclonal antibody

• 

  WB analysis using 12649-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12649-1-AP (TCIRG1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 12649-1-AP

  WB result of TCIRG1 antibody (12649-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-TCIRG1 transfected A431 cells.

• 

  WB analysis of U-937 using 12649-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 12649-1-AP (TCIRG1 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach using 12649-1-AP

  Immunohistochemical analysis of paraffin-embedded human normal stomach slide using 12649-1-AP (TCIRG1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 12649-1-AP

  Immunofluorescent analysis of HepG2 cells, using TCIRG1 antibody 12649-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

• 

  IF Staining of HepG2 using 12649-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using TCIRG1 antibody (12649-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

• Featured Product
• KD/KO Validated

TCIRG1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 12649-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

T-cell immune regulator 1, OPTB1, OC-116 kDa, OC116, ATP6V0A3

---

Tested Applications

• Positive WB detected in: HL-60 cells, U-937 cells, A431 cells, HuH-7 cells, SKOV-3 cells
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 6 publications below
• IHC: See 3 publications below
• IF: See 2 publications below

Product Information

12649-1-AP targets TCIRG1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3378

  Product name: Recombinant human TCIRG1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-395 aa of BC018133

  Sequence: CVSRLGELGLVEFRDLNASVSAFQRRFVVDVRRCEELEKTFTFLQEEVRRAGLVLPPPKGRLPAPPPRDLLRIQEETERLAQELRDVRGNQQALRAQLHQLQLHAAVLRQGHEPQLAAAHTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAPALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFLISYWGEQIGQKIRKITDCFHCHVFPFLQQEEARLGALQQLQQQSQELQEVLGETERFLSQVLGRVLQLLPPGQVQVHKMKAVYLALNQCSVSTTHKCLIAEAWCSVRDLPALQEALRDSSMEEGVSAVAHRIPCRDMPPTLIRTNRFTASFQGIVDAYGVGRYQEVNPAPYTIIT

• Full Name: T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3
• Calculated Molecular Weight: 830 aa, 93 kDa
• Observed Molecular Weight: 92 kDa, 65-70 kDa
• GenBank Accession Number: BC018133
• Gene Symbol: TCIRG1
• Gene ID (NCBI): 10312
• RRID: AB_10644329
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13488
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TCIRG1, also known as V ATPase 116 kDa isoform a3, TIRC7, OPTB1, belongs to the V-ATPase 116 kDa subunit family, TCIRG1 seems to be directly involved in T-cell activation (PubMed:10329006). Alternative splicing results in multiple transcript variants. Isoform long is highly expressed in osteoclastomas. Isoform short is highly expressed in thymus (PMID: 15809087, 24753205). Mutations in TCIRG1 are associated with Osteopetrosis, autosomal recessive 1 (OPTB1)( PMID: 11532986).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Oncotarget; PMID: 28978047; Authors - Enrica Balza
mouse	IF	Cancer Med; Therapeutic efficacy of proton transport inhibitors alone or in combination with cisplatin in triple negative and hormone sensitive breast cancer models.; Authors - Enrica Balza
human	WB	Oncol Rep; TIRC7 inhibits Th1 cells by upregulating the expression of CTLA‑4 and STAT3 in mice with acute graft‑versus‑host disease.; Authors - Feng Zhu ; KD Validated
pig	WB	Front Microbiol; Lactobacillus gasseri LA39 Activates the Oxidative Phosphorylation Pathway in Porcine Intestinal Epithelial Cells.; Authors - Jun Hu
human	IHC,WB	Cancers (Basel); Integrative Analysis Identifies TCIRG1 as a Potential Prognostic and Immunotherapy-Relevant Biomarker Associated with Malignant Cell Migration in Clear Cell Renal Cell Carcinoma; Authors - Chao Xu ; KD Validated
human	WB	Cancer Cell Int; Glycolysis-related biomarker TCIRG1 participates in regulation of renal cell carcinoma progression and tumor immune microenvironment by affecting aerobic glycolysis and AKT/mTOR signaling pathway; Authors - Sichen Di