TCIRG1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83351-6-RR (same clone as 83351-6-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83351-6-RR (TCIRG1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83351-6-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83351-6-PBS

  Biolayer interferometry (BLl) kinetic assays of 83351-6-RR against Human TCIRG1 were performed. The affinity constant is 2.14 nM.

TCIRG1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83351-6-PBS

Clone No.240166B2

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

Synonyms

a3, Atp6i, ATP6N1C, ATP6V0A3, OC 116 kDa, OC 116kDa, OC116, OPTB1, Stv1, T cell immune regulator 1, TCIRG1, TIRC7, V ATPase 116 kDa isoform a3, Vph1

---

Product Information

83351-6-PBS targets TCIRG1 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3378

  Product name: Recombinant human TCIRG1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-395 aa of BC018133

  Sequence: CVSRLGELGLVEFRDLNASVSAFQRRFVVDVRRCEELEKTFTFLQEEVRRAGLVLPPPKGRLPAPPPRDLLRIQEETERLAQELRDVRGNQQALRAQLHQLQLHAAVLRQGHEPQLAAAHTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAPALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFLISYWGEQIGQKIRKITDCFHCHVFPFLQQEEARLGALQQLQQQSQELQEVLGETERFLSQVLGRVLQLLPPGQVQVHKMKAVYLALNQCSVSTTHKCLIAEAWCSVRDLPALQEALRDSSMEEGVSAVAHRIPCRDMPPTLIRTNRFTASFQGIVDAYGVGRYQEVNPAPYTIIT

• Full Name: T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3
• Calculated Molecular Weight: 830 aa, 93 kDa
• GenBank Accession Number: BC018133
• Gene Symbol: TCIRG1
• Gene ID (NCBI): 10312
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q13488
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.