TCTA Polyclonal antibody

• 

  WB analysis using 15221-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15221-1-AP (TCTA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

TCTA Polyclonal Antibody for WB, ELISA

Cat No. 15221-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

TCTA

---

Tested Applications

• Positive WB detected in: HL-60 cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15221-1-AP targets TCTA in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7425

  Product name: Recombinant human TCTA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-103 aa of BC005157

  Sequence: MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHRE

• Full Name: T-cell leukemia translocation altered gene
• Calculated Molecular Weight: 11 kDa
• GenBank Accession Number: BC005157
• Gene Symbol: TCTA
• Gene ID (NCBI): 6988
• RRID: AB_3085453
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P57738
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TCTA is required for cellular fusion during osteoclastogenesis. TCTA mRNA is expressed ubiquitously in normal tissues, with the highest levels of expression seen in the kidney.