• Featured Product
  • KD/KO Validated

TDG Monoclonal antibody

TDG Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 66707-1-Ig
Clone No.1G2E2

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

1G2E2, EC:3.2.2.29, G/T mismatch-specific thymine DNA glycosylase, hTDG, thymine DNA glycosylase

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, HT-29 cells, COLO 320 cells, Jurkat cells, Raji cells, HSC-T6 cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66707-1-Ig targets TDG in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27408

Product name: Recombinant human TDG protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-410 aa of BC037557

Sequence: MEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVVNEQQMPEEVPAPAPAQEPVQEAPKGRKRKPRTTEPKQPVEPKKPVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYGMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDVQEVQYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENPCSSEPCGFSSNGLIESVELRGESAFSGIPNGQWMTQSFTDQIPSFSNHCGTQEQEEESHA

Predict reactive species
Full Name thymine-DNA glycosylase
Calculated Molecular Weight 410 aa, 46 kDa
Observed Molecular Weight 55-60 kDa
GenBank Accession NumberBC037557
Gene Symbol TDG
Gene ID (NCBI) 6996
RRIDAB_2882059
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ13569
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TDG belongs to the TDG/mug DNA glycosylase family. TDG corrects G/T mispairs to G/C pairs. It is capable of hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of the DNA and a mispaired thymine. In addition to the G/T, it can remove thymine also from C/T and T/T mispairs in the order G/T >> C/T > T/T. It has no detectable activity on apyrimidinic sites and does not catalyze the removal of thymine from A/T pairs or from single-stranded DNA. It can also remove uracil and 5-bromouracil from mispairs with guanine. RNF4 interacts with and requires the base excision repair enzymes TDG and APE1 for active demethylation (PMID:20696907). TDG is modified by SUMO-1 and SUMO-2/3.The molecular weight of non-modified TDG is 46 kDa and modified TDG is 55-60 kDa.

Protocols

Product Specific Protocols
WB protocol for TDG antibody 66707-1-IgDownload protocol
IHC protocol for TDG antibody 66707-1-IgDownload protocol
IF protocol for TDG antibody 66707-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...