TDG Monoclonal antibody

• 

  WB analysis using 66707-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66707-1-Ig (TDG antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 66707-1-Ig

  WB result of TDG antibody (66707-1-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TDG transfected HEK-293 cells.

• 

  IHC staining of human breast cancer using 66707-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66707-1-Ig (TDG antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 66707-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66707-1-Ig (TDG antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 66707-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 66707-1-Ig (TDG antibody) at dilution of 1:100 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• Featured Product
• KD/KO Validated

TDG Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66707-1-Ig

Clone No.1G2E2

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

1G2E2, EC:3.2.2.29, G/T mismatch-specific thymine DNA glycosylase, hTDG, thymine DNA glycosylase

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, HT-29 cells, COLO 320 cells, Jurkat cells, Raji cells, HSC-T6 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66707-1-Ig targets TDG in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27408

  Product name: Recombinant human TDG protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-410 aa of BC037557

  Sequence: MEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVVNEQQMPEEVPAPAPAQEPVQEAPKGRKRKPRTTEPKQPVEPKKPVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYGMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDVQEVQYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENPCSSEPCGFSSNGLIESVELRGESAFSGIPNGQWMTQSFTDQIPSFSNHCGTQEQEEESHA

• Full Name: thymine-DNA glycosylase
• Calculated Molecular Weight: 410 aa, 46 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC037557
• Gene Symbol: TDG
• Gene ID (NCBI): 6996
• RRID: AB_2882059
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q13569
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TDG belongs to the TDG/mug DNA glycosylase family. TDG corrects G/T mispairs to G/C pairs. It is capable of hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of the DNA and a mispaired thymine. In addition to the G/T, it can remove thymine also from C/T and T/T mispairs in the order G/T >> C/T > T/T. It has no detectable activity on apyrimidinic sites and does not catalyze the removal of thymine from A/T pairs or from single-stranded DNA. It can also remove uracil and 5-bromouracil from mispairs with guanine. RNF4 interacts with and requires the base excision repair enzymes TDG and APE1 for active demethylation (PMID:20696907). TDG is modified by SUMO-1 and SUMO-2/3.The molecular weight of non-modified TDG is 46 kDa and modified TDG is 55-60 kDa.