TELO2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TELO2 Polyclonal antibody (15975-1-AP)

• Featured Product
• KD/KO Validated

TELO2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 15975-1-AP Copied!

Publications (19)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

TEL2, Protein clk-2 homolog, Protein clk 2 homolog, KIAA0683, hCLK2

• 

  WB analysis using 15975-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15975-1-AP (TELO2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 15975-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 15975-1-AP (TELO2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Y79 using 15975-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 15975-1-AP (TELO2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of A431 using 15975-1-AP

  IP result of anti-TELO2 (IP:15975-1-AP, 4ug; Detection:15975-1-AP 1:500) with A431 cells lysate 1280 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 15975-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 15975-1-AP (TELO2 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 15975-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 15975-1-AP (TELO2 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 15975-1-AP

  Immunofluorescent analysis of HepG2 cells using 15975-1-AP (TELO2 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TELO2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, Y79 cells
• Positive IP detected in: A431 cells
• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15975-1-AP targets TELO2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8763

  Product name: Recombinant human TELO2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 488-837 aa of BC017188

  Sequence: DLDSDDEFVPYDMSGDRELKSSKAPAYVRDCVEALTTSEDIERWEAALRALEGLVYRSPTATREVSVELAKVLLHLEEKTCVVGFAGLRQRALVAVTVTDPAPVADYLTSQFYALNYSLRQRMDILDVLTLAAQELSRPGCLGRTPQPGSPSPNTPCLPEAAVSQPGSAVASDWRVVVEERIRSKTQRLSKGGPRQGPAGSPSRFNSVAGHFFFPLLQRFDRPLVTFDLLGEDQLVLGRLAHTLGALMCLAVNTTVAVAMGKALLEFVWALRFHIDAYVRQGLLSAVSSVLLSLPAARLLEDLMDELLEARSWLADVAEKDPDEDCRTLALRALLLLQRLKNRLLPPASP

• Full Name: TEL2, telomere maintenance 2, homolog (S. cerevisiae)
• Calculated Molecular Weight: 837 aa, 92 kDa
• Observed Molecular Weight: 92 kDa
• GenBank Accession Number: BC017188
• Gene Symbol: TELO2
• Gene ID (NCBI): 9894
• RRID: AB_2203337
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y4R8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TELO2 gene encodes a telomere length regulation protein TEL2 homolog. TELO2 may be involved in telomere length regulation and can form TTT complex with TTI1 and TTI2. TTT complex is required to stabilize protein levels of PIKK family proteins and is involved in the cellular resistance to DNA damage stresses, like ionizing radiation (IR), ultraviolet (UV) and MMC. The activity of mTORC1 and mTORC2 complexes, which regulate cell growth and survival in response to nutrient and hormonal signals, can be promoted, stabilized and maintained by TELO2.

Publications

What published studies show

Anti-TELO2 (Cat# 15975-1-AP) has accumulated 19 citations published in high-impact journals including Science, Nature Cell Biology, Molecular Cell, Science Advances, Cell Reports, American Journal of Human Genetics, and Genes & Development. Associated research fields encompass mTORC1 signaling, DNA damage response, multiple myeloma, neurodevelopmental disorders, autophagy regulation, Wnt/β-catenin signaling, and HPV-mediated pathogenesis.

Automatically generated from the 19 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Science; Direct sensing of dietary ω-6 linoleic acid through FABP5-mTORC1 signaling; Authors - Nikos Koundouros
human	WB	Nat Cell Biol; SCFFbxo9 and CK2 direct the cellular response to growth factor withdrawal via Tel2/Tti1 degradation and promote survival in multiple myeloma.; Authors - Fernández-Sáiz Vanesa V
human	WB	Mol Cell; The IMiD target CRBN determines HSP90 activity toward transmembrane proteins essential in multiple myeloma.; Authors - Michael Heider
human	WB	Mol Cell; FACS-based genome-wide CRISPR screens define key regulators of DNA damage signaling pathways; Authors - Min Huang
human	WB	Mol Cell; Genome-scale mapping of DNA damage suppressors through phenotypic CRISPR-Cas9 screens; Authors - Yichao Zhao ; KD Validated
mouse	WB	Mol Cell; Metabolic stress controls mTORC1 lysosomal localization and dimerization by regulating the TTT-RUVBL1/2 complex.; Authors - Sang Gyun Kim