Product Information
29324-1-PBS targets TFEC in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30973 Product name: Recombinant human TFEC protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 91-197 aa of BC029891 Sequence: LPMKREITETDTRALAKERQKKDNHNLIERRRRYNINYRIKELGTLIPKSNDPDMRWNKGTILKASVEYIKWLQKEQQRARELEHRQKKLEQANRRLLLRIQVFIRM Predict reactive species |
| Full Name | transcription factor EC |
| Calculated Molecular Weight | 347 aa, 39 kDa |
| Observed Molecular Weight | 37-50 kDa |
| GenBank Accession Number | BC029891 |
| Gene Symbol | TFEC |
| Gene ID (NCBI) | 22797 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14948 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
The DNA-binding factor TFE3 contains adjacent helix-loop-helix (HLH) and leucine zipper (LZ) domains flanked by an upstream basic region. These protein motifs are frequently observed in other transcription factors and are particularly common to members of the Myc family. TFEC shares a bHLH/LZ structure with TFE3 and a closely related protein microphthalmia-associated transcription factor (MITF), which is critically involved in melanocyte differentiation. The expression of TFEC is mainly in fibroblasts, myoblasts, chondrosarcoma cells and myeloma cells. 50kDa human TFEC isoforms are produced by alternative splicing (PMID: 29303964, PMID: 11467950).



