TGFBR1 Polyclonal antibody, PBS Only

• 

  WB analysis using 30117-1-AP (same clone as 30117-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30117-1-AP (TGFBR1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30117-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 30117-1-AP (same clone as 30117-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30117-1-AP (TGFBR1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30117-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 30117-1-AP (same clone as 30117-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 30117-1-AP (TGFBR1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30117-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 30117-1-AP (same clone as 30117-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 30117-1-AP (TGFBR1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30117-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse ovary using 30117-1-AP (same clone as 30117-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse ovary tissue using TGFBR1 antibody (30117-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30117-1-PBS in a different storage buffer formulation.

TGFBR1 Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 30117-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

TGFβ RI, AAT5, Activin A receptor type II-like protein kinase of 53kD, Activin receptor like kinase 5, Activin receptor-like kinase 5

---

Product Information

30117-1-PBS targets TGFBR1 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31620

  Product name: Recombinant human TGFBR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 34-180 aa of NM_004612

  Sequence: LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDL

• Full Name: transforming growth factor, beta receptor 1
• Calculated Molecular Weight: 56KD
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: NM_004612
• Gene Symbol: TGFBR1
• Gene ID (NCBI): 7046
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P36897
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TGFBR1 (TGF-beta receptor type-1) encodes a serine/threonine kinase receptor for transforming growth factor-beta. TGFB1, TGFB2 and TGFB3 signals are transduced from the cell surface to the cytoplasm and regulate lots of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. Mutations in both TGFBR2 and TGFBR1 were associated with early onset and aggressive thoracic aortic disease with MFS-like skeletal features, but also hypertelorism, craniosynostosis, developmental delay, cleft palate and bifid uvula, congenital heart disease and aneurysms, and dissections throughout the arterial tree with marked arterial tortuosity (PMID: 15731757, PMID: 27879313).