Tested Applications
| Positive WB detected in | HUVEC cells, HepG2 cells, BxPC-3 cells, HeLa cells, A549 cells, K-562 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15100-1-AP targets TGM2 in WB, IHC, IF, IP, CoIP, ChIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, canine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7439 Product name: Recombinant human TGM2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-349 aa of BC003551 Sequence: MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFSVVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLEASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPWNFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGRWDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTNYNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQP Predict reactive species |
| Full Name | transglutaminase 2 (C polypeptide, protein-glutamine-gamma-glutamyltransferase) |
| Calculated Molecular Weight | 77 kDa |
| Observed Molecular Weight | 77-80 kDa |
| GenBank Accession Number | BC003551 |
| Gene Symbol | TGM2 |
| Gene ID (NCBI) | 7052 |
| ENSEMBL Gene ID | ENSG00000198959 |
| RRID | AB_2202885 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P21980 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Transglutaminase 2 (TGM2) is a ubiquitous and multifunctional calcium-dependent enzyme belonging to the transglutaminase family. It is best known for its canonical activity of catalyzing the cross-linking of proteins by forming stable ε-(γ-glutamyl)lysine isopeptide bonds, which contributes to extracellular matrix stabilization and wound healing. Beyond this, TGM2 exhibits GTPase activity, allowing it to function as a signaling G-protein in intracellular processes. It is implicated in a wide range of physiological functions, including cell adhesion, proliferation, and apoptosis, as well as pathological conditions such as celiac disease, fibrosis, neurodegenerative disorders, and cancer metastasis, where its dysregulated expression often contributes to disease progression.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TGM2 antibody 15100-1-AP | Download protocol |
| IP protocol for TGM2 antibody 15100-1-AP | Download protocol |
| WB protocol for TGM2 antibody 15100-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-TGM2 antibody (Cat# 15100-1-AP) has 40 citations spanning journals including Nature, Nature Genetics, Nature Communications, Cancer Research, Autophagy, Cell Reports, Advanced Science, Cancer Letters, Redox Biology, and others. Research fields covered include oncology (pancreatic, gastric, colorectal, lung, bladder, breast, and glioblastoma cancers), autophagy, fibrosis, inflammation, metabolism, bone biology, neuroinflammation, and celiac disease. Applications cited include WB, IHC, IF, IP, CoIP, and ChIP.
| Species | Application | Title |
|---|---|---|
Cancer Commun (Lond) Glutamine metabolic microenvironment drives M2 macrophage polarization to mediate trastuzumab resistance in HER2-positive gastric cancer | ||
Cell Mol Immunol Platelet-derived serotonin epigenetically programs macrophage alternative activation to orchestrate type 2 airway inflammation. | ||
Cancer Res A Genome-Wide Synthetic Lethal Screen Identifies Spermidine Synthase as a Target to Enhance Erdafitinib Efficacy in FGFR-Mutant Bladder Cancer | ||
Drug Resist Updat Thiol oxidative stress-dependent degradation of transglutaminase2 via protein S-glutathionylation sensitizes 5-fluorouracil therapy in 5-fluorouracil-resistant colorectal cancer cells
|
Reviews
What customers say
One reviewer (4/5) used this antibody for Western Blot on human pancreatic beta cells at 1:1000 dilution in 5% milk/TBST blocking buffer. They reported it performed better than other TGM2 antibodies they had tried from different companies, yielding a stronger signal. However, they noted that the apparent molecular weight of the TGM2 band appeared lower than expected. Overall, the antibody was considered reliable and superior to alternatives they had previously experienced issues with.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Jon (Verified Customer) (02-15-2022) | DILuted as suggested in %5 milk TBST blocking buffer. We have had problems with other TGM2 antibodies from other companies, but this one seemed no work better and yield a better signal. However, the apparent molecular weight of the TGM2 band appeared to be at a much lower MW than it is supposed to.
 |
