TH1L Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TH1L Polyclonal antibody (11226-1-AP)

TH1L Polyclonal Antibody for WB, ELISA

Cat No. 11226-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ChIP, ELISA

Synonyms

HSPC130, Negative elongation factor C/D, NELF C, NELF C/D, NELF D, NELFD, TH1, TH1 like (Drosophila), TH1 like protein, TH1L

• 

  WB analysis of A549 using 11226-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 11226-1-AP (TH1L antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TH1L in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11226-1-AP targets TH1L in WB, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1750

  Product name: Recombinant human TH1L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 242-590 aa of BC014952

  Sequence: QAMMSVLAQEEQGGSAVRRIAQEVQRFAQEKGHDASQITLALGTAASYPRACQALGAMLSKGALNPADITVLFKMFTSMDPPPVELIRVPAFLDLFMQSLFKPGARINQDHKHKYIHILAYAASVVETWKKNKRVSINKDELKSTSKAVETVHNLCCNENKGASELVAELSTLYQCIRFPVVAMGVLKWVDWTVSEPRYFQLQTDHTPVHLALLDEISTCHQLLHPQVLQLLVKLFETEHSQLDVMEQLELKKTLLDRMVHLLSRGYVLPVVSYIRKCLEKLDTDISLIRYFVTEVLDVIAPPYTSDFVQLFLPILENDSIAGTIKTEGEHDPVTEFIAHCKSNFIMVN

• Full Name: TH1-like (Drosophila)
• Calculated Molecular Weight: 66 kDa
• Observed Molecular Weight: 66 kDa
• GenBank Accession Number: BC014952
• Gene Symbol: TH1L
• Gene ID (NCBI): 51497
• RRID: AB_2201665
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IXH7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The RNA Polymerase II antibody (Cat# 11226-1-AP) has 4 total citations published in Molecular Cell, PLoS Pathogens, Journal of Biological Chemistry, and Virology. These citations span research fields including transcription regulation, HIV-1 replication and latency establishment, chromatin remodeling, and T cell signaling. Applications used include Western blot, ChIP, and immunoprecipitation in human samples.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; CRL3ARMC5 ubiquitin ligase and Integrator phosphatase form parallel mechanisms to control early stages of RNA Pol II transcription; Authors - Roberta Cacioppo
human	chIP	PLoS Pathog; Strength of T cell signaling regulates HIV-1 replication and establishment of latency.; Authors - Matthew Gagne
human	WB,IP	J Biol Chem; NELF coordinates RNA polymerase II pausing, premature termination and chromatin remodeling to regulate HIV transcription.; Authors - Natarajan Malini M
human	ChIP	Virology; RNAP II processivity is a limiting step for HIV-1 transcription independent of orientation to and activity of endogenous neighboring promoters.; Authors - Katarzyna Kaczmarek Michaels