Tested Applications
| Positive FC detected in | Anti-CD3/CD28 treated mouse splenocytes |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) | FC : 0.25 ug per 10^6 cells in 100 μl suspension |
| This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL750-98026 targets TIGIT in FC applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg0925 Product name: Recombinant Mouse TIGIT protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 26-143 aa of NP_001139797.1 Sequence: GTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSVAQFQTAPLGGT Predict reactive species |
| Full Name | T cell immunoreceptor with Ig and ITIM domains |
| Calculated Molecular Weight | 26kDa |
| GenBank Accession Number | NP_001139797.1 |
| Gene Symbol | Tigit |
| Gene ID (NCBI) | 100043314 |
| RRID | AB_3673788 |
| Conjugate | CoraLite® Plus 750 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 755 nm / 780 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | A0A0B4J1G6 |
| Storage Buffer | PBS with 0.09% sodium azide, pH 7.3. |
| Storage Conditions | Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. |
Background Information
TIGIT (T-cell immunoreceptor with Ig and ITIM domains), also known as VSIG9 or VSTM3, is an immune receptor expressed on T cells, including Treg and memory subsets, as well as on NK cells (PMID: 19011627). It contains an immunoglobulin variable domain, a transmembrane domain and an immunoreceptor tyrosine-based inhibitory motif (ITIM). TIGIT binds to poliovirus receptor (PVR, also called CD155) with high affinity, and also to PVRL2 (CD112) with lower affinity. The interaction of TIGIT with PVR on dendritic cells increases the secretion of IL-10 and decreases the secretion of proinflammatory cytokine and suppresses T-cell activation by promoting the generation of mature immunoregulatory dendritic cells. TIGIT can inhibit NK cytotoxicity directly through its ITIM (PMID: 19815499).



