CoraLite® Plus 750 Anti-Mouse TIGIT Rabbit Recombinant Antibody

TIGIT Uni-rAb® Recombinant Antibody for FC
Cat No. CL750-98026
Clone No.240242G1

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

240242G1, Vstm3

Formulation:  PBS, Azide
PBS, Azide
Conjugate:  CoraLite® Plus 750
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inAnti-CD3/CD28 treated mouse splenocytes

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in 100 μl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL750-98026 targets TIGIT in FC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0925

Product name: Recombinant Mouse TIGIT protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 26-143 aa of NP_001139797.1

Sequence: GTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSVAQFQTAPLGGT

Predict reactive species
Full Name T cell immunoreceptor with Ig and ITIM domains
Calculated Molecular Weight26kDa
GenBank Accession NumberNP_001139797.1
Gene Symbol Tigit
Gene ID (NCBI) 100043314
RRIDAB_3673788
Conjugate CoraLite® Plus 750 Fluorescent Dye
Excitation/Emission Maxima Wavelengths755 nm / 780 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDA0A0B4J1G6
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

TIGIT (T-cell immunoreceptor with Ig and ITIM domains), also known as VSIG9 or VSTM3, is an immune receptor expressed on T cells, including Treg and memory subsets, as well as on NK cells (PMID: 19011627). It contains an immunoglobulin variable domain, a transmembrane domain and an immunoreceptor tyrosine-based inhibitory motif (ITIM). TIGIT binds to poliovirus receptor (PVR, also called CD155) with high affinity, and also to PVRL2 (CD112) with lower affinity. The interaction of TIGIT with PVR on dendritic cells increases the secretion of IL-10 and decreases the secretion of proinflammatory cytokine and suppresses T-cell activation by promoting the generation of mature immunoregulatory dendritic cells. TIGIT can inhibit NK cytotoxicity directly through its ITIM (PMID: 19815499).

Loading...
||
New chat Able
正在加载,请稍候...