Product Information
68866-4-PBS targets TIMM8A as part of a matched antibody pair:
MP50261-3: 68866-1-PBS capture and 68866-4-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | Human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag33190 Product name: Recombinant human TIMM8A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-97 aa of BC015093 Sequence: MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD Predict reactive species |
Full Name | translocase of inner mitochondrial membrane 8 homolog A (yeast) |
Calculated Molecular Weight | 11 kDa |
GenBank Accession Number | BC015093 |
Gene Symbol | TIMM8A |
Gene ID (NCBI) | 1678 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G Magarose purification |
UNIPROT ID | O60220 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |