TIMP-4 Polyclonal antibody, PBS Only

• 

  WB analysis of fetal human brain using 12326-1-AP (same clone as 12326-1-PBS)

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 12326-1-AP (TIMP-4 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12326-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HT-1080 using 12326-1-AP (same clone as 12326-1-PBS)

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 12326-1-AP (TIMP-4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12326-1-PBS in a different storage buffer formulation.

• 

  WB analysis of BxPC-3 using 12326-1-AP (same clone as 12326-1-PBS)

  BxPC-3 cells were subjected to SDS PAGE followed by western blot with 12326-1-AP (TIMP-4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12326-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 12326-1-AP (same clone as 12326-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 12326-1-AP (TIMP-4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12326-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 12326-1-AP (same clone as 12326-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12326-1-AP (TIMP-4 antibody at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12326-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 12326-1-AP (same clone as 12326-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12326-1-AP (TIMP-4 antibody at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 12326-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 12326-1-AP (same clone as 12326-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 12326-1-AP (TIMP-4 antibody at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12326-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 12326-1-AP (same clone as 12326-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 12326-1-AP (TIMP-4 antibody at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 12326-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 12326-1-AP (same clone as 12326-1-PBS)

  Immunofluorescent analysis of MCF-7 cells using 12326-1-AP (TIMP-4 antibody) at dilution of 1:25 and Rhodamine-Goat anti-Rabbit IgG. This data was developed using the same antibody clone with 12326-1-PBS in a different storage buffer formulation.

TIMP-4 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 12326-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

12326-1-PBS targets TIMP-4 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2927

  Product name: Recombinant human TIMP4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-224 aa of BC010553

  Sequence: MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP

• Full Name: TIMP metallopeptidase inhibitor 4
• Calculated Molecular Weight: 224 aa, 26 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC010553
• Gene Symbol: TIMP4
• Gene ID (NCBI): 7079
• RRID: AB_10638303
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99727
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.