TJAP1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68495-1-Ig (same clone as 68495-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68495-1-Ig (TJAP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 68495-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 68495-1-Ig (same clone as 68495-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 68495-1-Ig (TJAP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68495-1-PBS in a different storage buffer formulation.

TJAP1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68495-1-PBS

Clone No.1H1F10

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

1H1F10, PILT, Tight junction-associated protein 1, TJAP 1, TJP4

---

Product Information

68495-1-PBS targets TJAP1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11807

  Product name: Recombinant human TJAP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-351 aa of BC064401

  Sequence: MTSAAPAKKPYRKAPPEHRELRLEIPGSRLEQEEPLTDAERMKLLQEENEELRRRLASATRRTEALERELEIGQDCLELELGQSREELDKFKDKFRRLQNSYTASQRTNQELEDKLHTLIKKAEMDRKTLDWEIVELTNKLLDAKNTINKLEELNERYRLDCNLAVQLLKCNKSHFRNHKFADLPCELQDMVRKHLHSGQEAASPGPAPSLAPGAVVPTSVIARVLEKPESLLLNSAQSGSAGRPLAEDVFVHVDMSEGVPGDPASPPAPGSPTPQPNGECHSLGTARGSPEEELPLPAFEKLNPYPTPSPPHPLYPGRRVIEFSEDKVRIPRNSPLPNCTYATRQAISLS

• Full Name: tight junction associated protein 1 (peripheral)
• Calculated Molecular Weight: 547 aa, 61 kDa
• Observed Molecular Weight: 86-95 kDa
• GenBank Accession Number: BC064401
• Gene Symbol: TJAP1
• Gene ID (NCBI): 93643
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q5JTD0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TJAP1, also named as PILT and TJP4, is colocalized at the tight junctions. TJAP1 has some forms with MW 60 kDa (native) and 86-90 kDa (modified).