Anti-Human TLR3/CD283 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of human monocyte-derived immature dendritic cells using 98016-2-RR (same clone as 98016-2-PBS)

  1x10^6 human monocyte-derived immature dendritic cells were intracellularly stained with 0.25 ug Anti-Human TLR3/CD283 Rabbit Recombinant Antibody (98016-2-RR, Clone: 230445G9) or 0.25 ug Isotype Control and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). Cells were then stained with APC Anti-Human CD11c. Cells were incubated with FC Receptor Block prior to fixing and staining. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 98016-2-PBS in a different storage buffer formulation.

• 

  FC experiment of human monocyte-derived immature dendritic cells using 98016-2-RR (same clone as 98016-2-PBS)

  1x10^6 human monocyte-derived immature dendritic cells were intracellularly stained with 0.25 ug Anti-Human TLR3/CD283 Rabbit Recombinant Antibody (98016-2-RR, Clone: 230445G9) (red) or 0.25 ug Isotype Control (blue) and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). Cells were then stained with APC Anti-Human CD11c. Cells were incubated with FC Receptor Block prior to fixing and staining. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 98016-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 98016-2-RR

  Biolayer interferometry (BLl) kinetic assays of 98016-2-RR against Human TLR3/CD283 were performed. The affinity constant is below 1 pM.

TLR3/CD283 Recombinant Antibody for FC (Intra)

Cat No. 98016-2-PBS

Clone No.230445G9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Synonyms

TLR3, Toll-like receptor 3, toll like receptor 3, CD283, 230445G9

---

Product Information

98016-2-PBS targets TLR3/CD283 in FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34044

  Product name: Recombinant human TLR3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 725-904 aa of BC094737

  Sequence: FEGWRISFYWNVSVHRVLGFKEIDRQTEQFEYAAYIIHAYKDKDWVWEHFSSMEKEDQSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDPLCKRFKVHHAVQQAIEQNLDSIILVFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERIGAFRHKLQVALGSKNSVH

• Full Name: toll-like receptor 3
• Calculated Molecular Weight: 904 aa, 104 kDa
• GenBank Accession Number: BC094737
• Gene Symbol: TLR3
• Gene ID (NCBI): 7098
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O15455
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TLR3 belongs to the Toll-like receptor family which is important in the innate immune response to pathogens. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. TLR3 is a nucleotide-sensing TLR that is activated by double-stranded RNA. Upon recognition of dsRNA, TLR3 transmits signals via the adaptor protein TICAM-1/TRIF, leading to the induction of type I IFN, cytokine/chemokine production, and dendritic cell (DC) maturation (PMID: 18262679).