TMCO1 Recombinant monoclonal antibody

• 

  WB analysis using 86440-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86440-1-RR (TMCO1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 86440-1-RR

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 86440-1-RR (TMCO1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 86440-1-RR

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 86440-1-RR (TMCO1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity of 86440-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86440-1-RR against Human TMCO1 were performed. The affinity constant is 0.73 nM.

TMCO1 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 86440-1-RR

Clone No.251064F7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

HP10122, PCIA3, PNAS 136, RP11 466F5.7, TMCC4

---

Tested Applications

• Positive WB detected in: A549 cells, L02 cells, Calu-3 cells, MDA-MB-231 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86440-1-RR targets TMCO1 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26278

  Product name: Recombinant human TMCO1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 111-188 aa of NM_019026

  Sequence: MGRVVAKLPFTPLSYIQGLSHRNLLGDDTTDCSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS

• Full Name: transmembrane and coiled-coil domains 1
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: NM_019026
• Gene Symbol: TMCO1
• Gene ID (NCBI): 54499
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UM00
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TMCO1, also known as TMCC4, PNAS-10, and PNAS-136, is a 188 amino acid protein, which is widely expressed in adult and fetal tissues, with higher levels in thymus, prostate, testis and small intestine and lower levels in brain, placenta, lung and kidney (PubMed:10393320, PubMed:20018682). TMCO1 as a Calcium-selective channel is required to prevent calcium stores from overfilling, thereby playing a key role in calcium homeostasis (PubMed:27212239). In response to endoplasmic reticulum overloading, TMCO1, assembles into a homotetramer, forming a functional calcium-selective channel, regulating the calcium content in endoplasmic reticulum store (PubMed:27212239).