TMEM200A Polyclonal antibody

• 

  IHC staining of mouse cerebellum using 25378-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 25378-1-AP (TMEM200A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 25378-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 25378-1-AP (TMEM200A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 25378-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using TMEM200A antibody (25378-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of NCCIT using 25378-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed NCCIT cells using TMEM200A antibody (25378-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

TMEM200A Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 25378-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, ELISA

Synonyms

KIAA1913, TMEM200A, transmembrane protein 200A, TTMA, TTMC

---

Tested Applications

• Positive IHC detected in: mouse cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells, NCCIT cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25378-1-AP targets TMEM200A in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21958

  Product name: Recombinant human TMEM200A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 170-491 aa of BC044246

  Sequence: IHTLRIKEQRQMNGMYTGLMGETEVKQNGSSCASRLAANTIASFSGFRSSFRMDSSVEEDELMLNEGKSSGHLMPPLLSDSSVSVFGLYPPPSKTTDDKTSGSKKCETKSIVSSSISAFTLPVIKLNNCVIDEPSIDNITEDADNLKSRSRNLSMDSLVVPLPNTSESFQPVSTVLPRNNSIGESLSSQYKSSMALGPGAGQLLSPGAARRQFGSNTSLHLLSSHSKSLDLDRGPSTLTVQAEQRKHPSWPRLDRNNSKGYMKLENKEDPMDRLLVPQVAIKKDFTNKEKLLMISRSHNNLSFEHDEFLSNNLKRGTSETRF

• Full Name: transmembrane protein 200A
• Calculated Molecular Weight: 491 aa, 54 kDa
• Observed Molecular Weight: 54 kDa
• GenBank Accession Number: BC044246
• Gene Symbol: TMEM200A
• Gene ID (NCBI): 114801
• RRID: AB_3085794
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86VY9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.