TMEM27 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse pancreas using 14571-1-AP (same clone as 14571-1-PBS)

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 14571-1-AP (TMEM27 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14571-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 14571-1-AP (same clone as 14571-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 14571-1-AP (TMEM27 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14571-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human spleen using 14571-1-AP (same clone as 14571-1-PBS)

  human spleen tissue were subjected to SDS PAGE followed by western blot with 14571-1-AP (TMEM27 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14571-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 14571-1-AP (same clone as 14571-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 14571-1-AP (TMEM27 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14571-1-PBS in a different storage buffer formulation.

TMEM27 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 14571-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

14571-1-PBS targets TMEM27 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6187

  Product name: Recombinant human TMEM27 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 27-143 aa of BC050606

  Sequence: VRLSIRTALGDKAYAWDTNEEYLFKAMVAFSMRKVPNREATEISHVLLCNVTQRVSFWFVVTDPSKNHTLPAVEVQSAIRMNKNRINNAFFLNDQTLEFLKIPSTLAPPMDPSVPIW

• Full Name: transmembrane protein 27
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC050606
• Gene Symbol: TMEM27
• Gene ID (NCBI): 57393
• RRID: AB_2204913
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HBJ8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TMEM27 (also termed collectrin), a 46 kDa type I transmembrane protein, is a homolog of the noncatalytic domain of angiotensin-converting enzyme-related carboxypeptidase (Ace2). Its expression has only been reported in the brush border membrane of the proximal tubules and collecting ducts of the kidney and in the pancreatic b cell (PMID: 11278314, 16330324). Overexpression of TMEM27 in b cells leads to increased proliferation in vitro and increased pancreatic b cell mass in vivo, and also has been reported to augment glucosestimulated INS secretion (GSIS) (PMID: 16330324, 16330323). The abundance of TMEM27 protein in b cells is furthermore regulated by ectodomain cleavage, which leads to two cleavage products, a 25 kDa N-terminal part that is released into the extracellular space (the shed fragment), and a 22 kDa C-terminal fragment (CTF) remaining in the membrane that is rapidly degraded (PMID: 16330324). TMEM27 is an N-glycosylated protein and can form dimers with MW of 64-75 kDa(patent US 20100119489 A1). TMEM27 can be used as a beta cell mass biomarker (PMID: 20386877, 21907142).