TMEM27 Polyclonal antibody, PBS Only

TMEM27 Polyclonal Antibody for WB, Indirect ELISA
Cat No. 24059-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

24059-1-PBS targets TMEM27 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag21257

Product name: Recombinant human TMEM27 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 163-222 aa of BC050606

Sequence: LSGIWQRRRKNKEPSEVDDAEDKCENMITIENGIPSDPLDMKGGHINDAFMTEDERLTPL

Predict reactive species
Full Name transmembrane protein 27
Calculated Molecular Weight 25 kDa
Observed Molecular Weight 23 kDa
GenBank Accession NumberBC050606
Gene Symbol TMEM27
Gene ID (NCBI) 57393
RRIDAB_2879419
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9HBJ8
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TMEM27 (also termed collectrin), a 46 kDa type I transmembrane protein, is a homolog of the noncatalytic domain of angiotensin-converting enzyme-related carboxypeptidase (Ace2). Its expression has only been reported in the brush border membrane of the proximal tubules and collecting ducts of the kidney and in the pancreatic b cell (PMID: 11278314, 16330324). Overexpression of TMEM27 in b cells leads to increased proliferation in vitro and increased pancreatic b cell mass in vivo (PMID: 16330324, 16330323). The abundance of TMEM27 protein in b cells is furthermore regulated by ectodomain cleavage, which leads to two cleavage products, a 25 kDa N-terminal part that is released into the extracellular space (the shed fragment), and a 22 kDa C-terminal fragment (CTF) remaining in the membrane that is rapidly degraded (PMID: 16330324). TMEM27 is an N-glycosylated protein and can form dimers with MW of 64-75 kDa(patent US 20100119489 A1). TMEM27 can be used as a beta cell mass biomarker (PMID: 20386877, 21907142).

Loading...
||
New chat Able
正在加载,请稍候...