TMEM33 Polyclonal antibody, PBS Only

• 

  WB analysis using 30639-1-AP (same clone as 30639-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30639-1-AP (TMEM33 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30639-1-PBS in a different storage buffer formulation.

TMEM33 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 30639-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Transmembrane protein 33, SHINC-3, SHINC3, Protein DB83, DB83

---

Product Information

30639-1-PBS targets TMEM33 in WB, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32368

  Product name: Recombinant human TMEM33 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 177-247 aa of BC000948

  Sequence: SGQGSLLQPFIYYRFLTLRYSSRRNPYCRTLFNELRIVVEHIIMKPACPLFVRRLCLQSIAFISRLAPTVP

• Full Name: transmembrane protein 33
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 27-30 kDa
• GenBank Accession Number: BC000948
• Gene Symbol: TMEM33
• Gene ID (NCBI): 55161
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P57088
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TMEM33 (transmembrane protein 33), also known as DB83. It is expected to be located in endoplasmic reticulum membrane and nucleus envelope. The protein is widely expressed in prostate cancer and several cancer cell lines (at protein level). And expressed at higher levels in endocrine-resistant breast cancer cells as compared to endocrine-sensitive breast cancer cells. It is also expressed at higher levels in early recurrence breast cancer tissues as compared to non-recurrent breast tumors. The calculated molecular weight of TMEM33 is 28 kDa. It is suggest that TMEM33 has a potency to suppress the membrane-shaping activity of reticulons, thereby regulating the tubular structure of ER (PMID: 25612671).