ASC/TMS1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ASC/TMS1 Polyclonal antibody (10500-1-AP)

• Featured Product
• KD/KO Validated

ASC/TMS1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 10500-1-AP

Publications(455)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

PYCARD, hASC, Caspase recruitment domain-containing protein 5, CARD5, ASC

• 

  WB analysis using 10500-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10500-1-AP (ASC/TMS1 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10500-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10500-1-AP (ASC/TMS1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10500-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10500-1-AP (ASC/TMS1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 10500-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 10500-1-AP (TMS1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Raji using 10500-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 10500-1-AP (TMS1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HL-60 using 10500-1-AP

  IP result of anti-ASC/TMS1 (IP:10500-1-AP, 4ug; Detection:10500-1-AP 1:10000) with HL-60 cells lysate 2240 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 10500-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10500-1-AP (ASC/TMS1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 10500-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10500-1-AP (ASC/TMS1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 10500-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10500-1-AP (ASC/TMS1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 10500-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10500-1-AP (TMS1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 10500-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed MCF-7 cells using 10500-1-AP (TMS1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HL-60 cells, A549 cells, Raji cells, U-937 cells, THP-1 cells
• Positive IP detected in: HL-60 cells
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10500-1-AP targets ASC/TMS1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, pig, canine, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0774

  Product name: Recombinant human TMS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-135 aa of BC004470

  Sequence: MGRARDAILDALENLTAEELKKFKLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS

• Full Name: PYD and CARD domain containing
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 22-25 kDa
• GenBank Accession Number: BC004470
• Gene Symbol: ASC/TMS1
• Gene ID (NCBI): 29108
• RRID: AB_2174862
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9ULZ3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PYCARD , also known as ASC or TMS1, is a 195 amino acid protein containing an N-terminal Pyrin-like domain (PYD) and an 87 residue C-terminal Caspase-associated recruitment domain (CARD). It promotes caspase-mediated apoptosis which is mediated predominantly through the activation of caspase-9.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IP	Immunity; Macrophage metabolic exhaustion and PANoptotic cell death drive chronic tissue inflammation in rheumatoid arthritis.; Authors - Tao Huang
human	WB	Cancer Res; Role of hMOF-dependent histone H4 lysine 16 acetylation in the maintenance of TMS1/ASC gene activity.; Authors - Kapoor-Vazirani Priya P
human	WB,IHC	Cancer Res; Silencing of TMS1/ASC promotes resistance to anoikis in breast epithelial cells.; Authors - Parsons Melissa J MJ ; KD Validated
		Autophagy; CX3CR1(+) macrophages aggravate doxorubicin-induced cardiomyopathy by impairing cardiac mitophagy via the CSF1R-PARP1-IL1B axis.; Authors - Yiping Shi
	CoIP	Nat Commun; Augmented microglial endoplasmic reticulum-mitochondria contacts mediate depression-like behavior in mice induced by chronic social defeat stress; Authors - Jia-Rui Zhang
human	WB,IF,CoIP	Nat Commun; RIPK1 kinase drove brain microvascular endothelial cells death and blood-brain barrier disruption in neonatal Escherichia coli meningitis.; Authors - Xuhang Wang

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Monica (Verified Customer) (06-11-2026)

The ASC/TMS1 Polyclonal Antibody showed strong detection of ASC/PYCARD with low background signal. Overall, it has been a reliable reagent for inflammasome studies

• Applications: Western Blot