Tested Applications
| Positive IP detected in | mouse skeletal muscle tissue |
| Positive IHC detected in | mouse skeletal muscle tissue, mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse heart tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 11 publications below |
| IHC | See 6 publications below |
| IF | See 4 publications below |
Product Information
19850-1-AP targets Thymosin beta 4 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13914 Product name: Recombinant human TMSB4X protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-63 aa of BC001631 Sequence: AQTRLRSYSCASLRFSSATMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES Predict reactive species |
| Full Name | thymosin beta 4, X-linked |
| Calculated Molecular Weight | 63 aa, 7 kDa |
| Observed Molecular Weight | 5 kDa |
| GenBank Accession Number | BC001631 |
| Gene Symbol | Thymosin beta 4 |
| Gene ID (NCBI) | 7114 |
| RRID | AB_10642437 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P62328 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Thymosin beta 4 (Tβ4), encoded by TMSB4X gene, is an actin sequestering protein which plays an important role in the organization of the cytoskeleton. Numerous studies have demonstrated the effects of Tβ4 on cell migration, proliferation, apoptosis and inflammation after exogenous treatment (PMID: 22652458). Recently, novel findings provided compelling evidence that Tβ4 played a key role in facilitating tumor metastasis and angiogenesis. It has been found that Tβ4 expressed increasingly in a number of metastatic tumors, thus providing a potential target of opportunity for cancer management, especially for cancer metastasis therapy (PMID: 22856429).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Thymosin beta 4 antibody 19850-1-AP | Download protocol |
| IHC protocol for Thymosin beta 4 antibody 19850-1-AP | Download protocol |
| IP protocol for Thymosin beta 4 antibody 19850-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Tβ4-Engineered ADSC Extracellular Vesicles Rescue Cell Senescence Through Separable Microneedle Patches for Diabetic Wound Healing | ||
Nat Commun Single-cell transcriptomic analysis of the tumor ecosystems underlying initiation and progression of papillary thyroid carcinoma | ||
Front Med Distinct immune escape and microenvironment between RG-like and pri-OPC-like glioma revealed by single-cell RNA-seq analysis | ||
J Mol Cell Biol Nanog suppresses cell migration by downregulating thymosin β4 and Rnd3.
| ||
Haematologica Thymosin β4 is essential for thrombus formation by controlling the G-actin/F-actin equilibrium in platelets.
|





















