Product Information
61052-1-PBS targets TMSB4X as part of a matched antibody pair:
MP51621-1: 61052-1-PBS capture and 61053-1-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13914 Product name: Recombinant human TMSB4X protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-63 aa of BC001631 Sequence: AQTRLRSYSCASLRFSSATMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES Predict reactive species |
| Full Name | thymosin beta 4, X-linked |
| Calculated Molecular Weight | 63 aa, 7 kDa |
| GenBank Accession Number | BC001631 |
| Gene Symbol | Thymosin beta 4 |
| Gene ID (NCBI) | 7114 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P62328 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



