HVEM/TNFRSF14 Polyclonal antibody

• 

  IHC staining of human spleen using 10138-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 10138-1-AP (HVEM/TNFRSF14 antibody at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human spleen using 10138-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 10138-1-AP (HVEM/TNFRSF14 antibody at dilution of 1:200 (under 40x lens).

HVEM/TNFRSF14 Polyclonal Antibody for IHC, ELISA

Cat No. 10138-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

ATAR, Herpes virus entry mediator A, Herpesvirus entry mediator A, HVEA, HVEM, LIGHTR, TNFRSF14, TR2

---

Tested Applications

• Positive IHC detected in: human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IHC: See 2 publications below

Product Information

10138-1-AP targets HVEM/TNFRSF14 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0186

  Product name: Recombinant human TNFRSF14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-217 aa of BC002794

  Sequence: MEPPGDWGPPPWRSTPRTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCS

• Full Name: tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)
• Calculated Molecular Weight: 30 kDa
• GenBank Accession Number: BC002794
• Gene Symbol: TNFRSF14
• Gene ID (NCBI): 8764
• RRID: AB_2203686
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92956
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The mammalian tumor necrosis factor receptor (TNFR) family consists of 10 cell-surface proteins that regulate development and homeostasis of the immune system. Member 14 of TNFR (TNFRSF14, also named as TR2, ATAR, HVEA, HVEM, LIGHTR) was also identified as a mediator of herpesvirus entry into mammalian cells. The cytoplasmic region of TNFRSF14 bound to several members of the TNFR-associated factor (TRAF) family, namely TRAF1, TRAF2, TRAF3, and TRAF5. Transient transfection into human 293 cells caused marked activation of nuclear factor- B (NF- B), a transcriptional regulator of multiple immunomodulatory and inflammatory genes.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cancer Immunol Res; Targeting Triple-Negative Breast Cancer with Combination Therapy of EGFR CAR T Cells and CDK7 Inhibition.; Authors - Lin Xia
human	WB	Obesity (Silver Spring); Characterization of herpes virus entry mediator as a factor linked to obesity.; Authors - Judit Bassols
human	IHC	EBioMedicine; Immune checkpoint molecule herpes virus entry mediator is overexpressed and associated with poor prognosis in human glioblastoma.; Authors - Ming-Zhi Han
human	IHC	Dig Liver Dis; Increased expression of TNFRSF14 and LIGHT in biliary epithelial cells of patients with primary sclerosing cholangitis; Authors - Sachiko Kanai
mouse	WB	Immun Inflamm Dis; Tumor Cell-Expressed Herpesvirus Entry Mediator Regulates Proliferation and Adaptive Immunity in Ovarian Cancer; Authors - Yun Lu ; KD Validated