TNFSF15 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83700-3-RR (same clone as 83700-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83700-3-RR (TNFSF15 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83700-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83700-3-RR

  Biolayer interferometry (BLl) kinetic assays of 83700-3-RR against Human TNFSF15 were performed. The affinity constant is 0.291 nM.

TNFSF15 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 83700-3-PBS

Clone No.251018A11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

TNFSF 15, Tumor necrosis factor ligand superfamily member 15, Tumor necrosis factor ligand superfamily member 15, membrane form, Tumor necrosis factor ligand superfamily member 15, secreted form

---

Product Information

83700-3-PBS targets TNFSF15 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg32092

  Product name: Recombinant Human TL1A/TNFSF15 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: N-6*his

  Domain: 72-251 aa of BC074941

  Sequence: LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

• Full Name: tumor necrosis factor (ligand) superfamily, member 15
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC074941
• Gene Symbol: TNFSF15
• Gene ID (NCBI): 9966
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95150
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Tumor necrosis factor ligand superfamily member 15 (TNFSF15) is also named as TL1 and VEGI. And it belongs to the tumor necrosis factor family. It is a receptor for TNFRSF25 and TNFRSF6B. VEGI induced degradation of IκB alpha, and nuclear translocation of p65 subunit of NFκB by activating NFκB (PMID: 10597252). TL1A mediates activation and apoptosis of NFκB in DR3-expressing cell lines (PMID: 11911831). Overexpression by cancer cells of a secretable VEGI fusion protein resulted in abrogation of xenograft tumor progression. The isoforms show endothelial cell-specific expression and are generated from a 17 kb human gene by alternative splicing (PMID: 11923219). In addition, VEGI can inhibit vascular endothelial growth and angiogenesis (in vitro) (PMID: 9872942).