TNFSF15 Recombinant monoclonal antibody, PBS Only

TNFSF15 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 83700-3-PBS
Clone No.251018A11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

TNFSF 15, Tumor necrosis factor ligand superfamily member 15, Tumor necrosis factor ligand superfamily member 15, membrane form, Tumor necrosis factor ligand superfamily member 15, secreted form

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83700-3-PBS targets TNFSF15 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg32092

Product name: Recombinant Human TL1A/TNFSF15 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec

Tag: N-6*his

Domain: 72-251 aa of BC074941

Sequence: LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Predict reactive species
Full Name tumor necrosis factor (ligand) superfamily, member 15
Calculated Molecular Weight 28 kDa
Observed Molecular Weight28 kDa
GenBank Accession NumberBC074941
Gene Symbol TNFSF15
Gene ID (NCBI) 9966
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO95150
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Tumor necrosis factor ligand superfamily member 15 (TNFSF15) is also named as TL1 and VEGI. And it belongs to the tumor necrosis factor family. It is a receptor for TNFRSF25 and TNFRSF6B. VEGI induced degradation of IκB alpha, and nuclear translocation of p65 subunit of NFκB by activating NFκB (PMID: 10597252). TL1A mediates activation and apoptosis of NFκB in DR3-expressing cell lines (PMID: 11911831). Overexpression by cancer cells of a secretable VEGI fusion protein resulted in abrogation of xenograft tumor progression. The isoforms show endothelial cell-specific expression and are generated from a 17 kb human gene by alternative splicing (PMID: 11923219). In addition, VEGI can inhibit vascular endothelial growth and angiogenesis (in vitro) (PMID: 9872942).

Loading...
||
New chat

Able

正在加载,请稍候...