TNNT1 Polyclonal antibody

• 

  WB analysis of mouse skeletal muscle using 15893-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15893-1-AP (TNNT1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human skeletal muscle using 15893-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15893-1-AP (TNNT1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

TNNT1 Polyclonal Antibody for WB, ELISA

Cat No. 15893-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, ELISA

Synonyms

ANM, STNT, TNNT1, TNT, TNTS

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue, human skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below

Product Information

15893-1-AP targets TNNT1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8702

  Product name: Recombinant human TNNT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 46-297 aa of BC022086

  Sequence: RMSDTEEQEYEEEQPEEEAAEEEEEEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKVRILSERKKPLDIDYMGEEQLREKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK

• Full Name: troponin T type 1 (skeletal, slow)
• Calculated Molecular Weight: 252aa,27 kDa; 192aa,21 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC022086
• Gene Symbol: TNNT1
• Gene ID (NCBI): 7138
• RRID: AB_2240819
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P13805
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Int J Mol Sci; Identification of Overexpressed Genes in Malignant Pleural Mesothelioma.; Authors - Federica Morani
mouse	WB	J Muscle Res Cell Motil; Differential regulation of Actn2 and Actn3 expression during unfolded protein response in C2C12 myotubes.; Authors - Nagakatsu Harada
chicken	WB	Food Chem; New perspective for Calpain-Mediated regulation of meat Quality: Unveiling the impact on mitochondrial pathway apoptosis in post-mortem; Authors - Yunhao Ma
mouse	WB	J Integr Med; Strychni Semen and its active compounds promote axon regeneration following peripheral nerve injury by suppressing myeloperoxidase in the dorsal root ganglia; Authors - Yan Zhang