TNNT1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TNNT1 Polyclonal antibody (15893-1-AP)

TNNT1 Polyclonal Antibody for WB, ELISA

Cat No. 15893-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, ELISA

Synonyms

ANM, STNT, TNNT1, TNT, TNTS

• 

  WB analysis of mouse skeletal muscle using 15893-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15893-1-AP (TNNT1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human skeletal muscle using 15893-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15893-1-AP (TNNT1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TNNT1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue, human skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15893-1-AP targets TNNT1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8702

  Product name: Recombinant human TNNT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 46-297 aa of BC022086

  Sequence: RMSDTEEQEYEEEQPEEEAAEEEEEEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKVRILSERKKPLDIDYMGEEQLREKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK

• Full Name: troponin T type 1 (skeletal, slow)
• Calculated Molecular Weight: 252aa,27 kDa; 192aa,21 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC022086
• Gene Symbol: TNNT1
• Gene ID (NCBI): 7138
• RRID: AB_2240819
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P13805
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The TNNT1 Polyclonal antibody (Cat# 15893-1-AP) has 5 citations. These appear in Food Chemistry, Clinical Epigenetics, International Journal of Molecular Sciences, Journal of Integrative Medicine, and Journal of Muscle Research and Cell Motility. The research fields span meat quality and mitochondrial apoptosis, epigenetic regulation in gastrointestinal cancers, malignant pleural mesothelioma gene expression, axon regeneration after peripheral nerve injury, and actin regulation during unfolded protein response in myotubes.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
chicken	WB	Food Chem; New perspective for Calpain-Mediated regulation of meat Quality: Unveiling the impact on mitochondrial pathway apoptosis in post-mortem; Authors - Yunhao Ma
		Clin Epigenetics; Epigenetic regulation of TNNT1 in gastrointestinal cancers prognostic implications and clinical significance; Authors - Jin Xie
human	WB	Int J Mol Sci; Identification of Overexpressed Genes in Malignant Pleural Mesothelioma.; Authors - Federica Morani
mouse	WB	J Integr Med; Strychni Semen and its active compounds promote axon regeneration following peripheral nerve injury by suppressing myeloperoxidase in the dorsal root ganglia; Authors - Yan Zhang
mouse	WB	J Muscle Res Cell Motil; Differential regulation of Actn2 and Actn3 expression during unfolded protein response in C2C12 myotubes.; Authors - Nagakatsu Harada