TOE1 Polyclonal antibody

• 

  WB analysis using 30221-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30221-1-AP (TOE1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach cancer using 30221-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 30221-1-AP (TOE1 antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 30221-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using TOE1 antibody (30221-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

TOE1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 30221-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Target of EGR1 protein 1

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30221-1-AP targets TOE1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31470

  Product name: Recombinant human TOE1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 318-510 aa of BC009364

  Sequence: SHDIDLIIDTDEAAAEDKRRRRRRREKRKRALLNLPGTQTSGEAKDGPPKKQVCGDSIKPEETEQEVAADETRNLPHSKQGNKNDLEMGIKAARPEIADRATSEVPGSQASPNPVPGDGLHRAGFDAFMTGYVMAYVEVSQGPQPCSSGPWLPECHNKVYLSGKAVPLTVAKSQFSRSSKAHNQKMKLTWGSS

• Full Name: target of EGR1, member 1 (nuclear)
• Calculated Molecular Weight: 510 aa, 57 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC009364
• Gene Symbol: TOE1
• Gene ID (NCBI): 114034
• RRID: AB_2935533
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96GM8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TOE1, also known as hCaf1z, belongs to the DEDD family of deadenylases. TOE1 was initially identified as a direct target gene of ERG1, an immediate early transcription factor. TOE1 encodes an Asp-Glu-Asp-Asp deadenylase that specifically localizes to Cajal bodies in the nucleus, where assembly and maturation of small nuclear ribonucleoprotein particles, and telomerase ribonucleoprotein complex take place (PMID: 36257135). TOE1 has 2 isoforms with the molecular mass of 48 and 57 kDa.