TOM1 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse liver using 25813-1-AP (same clone as 25813-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 25813-1-AP (TOM1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25813-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 25813-1-AP (same clone as 25813-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 25813-1-AP (TOM1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25813-1-PBS in a different storage buffer formulation.

TOM1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25813-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

25813-1-PBS targets TOM1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22931

  Product name: Recombinant human TOM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 143-492 aa of BC005144

  Sequence: DLRRKGLEFPMTDLDMLSPIHTPQRTVFNSETQSGQDSVGTDSSQQEDSGQHAAPLPAPPILSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGLQSLEASGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGAIPVTQACLMEDIEQWLSTDVGNDAEEPKGVTSEEFDKFLEERAKAADRLPNLSSPSAEGPPGPPSGPAPRKKTQEKDDDMLFAL

• Full Name: target of myb1 (chicken)
• Calculated Molecular Weight: 492 aa, 54 kDa
• Observed Molecular Weight: 50-54 kDa
• GenBank Accession Number: BC005144
• Gene Symbol: TOM1
• Gene ID (NCBI): 10043
• RRID: AB_2880247
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60784
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.