• Featured Product
  • KD/KO Validated

TOMM40 Polyclonal antibody

TOMM40 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA
Cat No. 18409-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

TOM40, C19orf1, D19S1177E, p38.5, PER EC1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, HepG2 cells, mouse kidney tissue, rat kidney tissue
Positive IP detected inmouse liver tissue
Positive IHC detected inhuman liver tissue, mouse heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells, HeLa cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

18409-1-AP targets TOMM40 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, monkey, bovine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13065

Product name: Recombinant human TOMM40 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-361 aa of BC017224

Sequence: MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG

Predict reactive species
Full Name translocase of outer mitochondrial membrane 40 homolog (yeast)
Calculated Molecular Weight 38 kDa
Observed Molecular Weight 38 kDa
GenBank Accession NumberBC017224
Gene Symbol TOMM40
Gene ID (NCBI) 10452
RRIDAB_2303725
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO96008
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The translocase of outer mitochondria membrane 40 (TOMM40, also known as TOM40), located in the center of the TOM complex, is a channel-forming subunit of translocase. It can facilitate the fluid movement of preproteins into the mitochondria by associating with TOMM20. TOMM40 plays a role in the assembly of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) by forming a complex with BCAP31 and mediating the translocation of Complex I components from the cytosol to the mitochondria (PMID: 31206022). TOMM40 has been reported to be associated with late-onset neurodegenerative diseases such as Alzheimer's disease and Parkinson's disease.

Protocols

Product Specific Protocols
WB protocol for TOMM40 antibody 18409-1-APDownload protocol
IHC protocol for TOMM40 antibody 18409-1-APDownload protocol
IF protocol for TOMM40 antibody 18409-1-APDownload protocol
IP protocol for TOMM40 antibody 18409-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Nature

The ADP/ATP translocase drives mitophagy independent of nucleotide exchange.

Authors - Atsushi Hoshino
humanWB

Nature

In vivo imaging of mitochondrial membrane potential in non-small-cell lung cancer.

Authors - Milica Momcilovic
humanIF

Cell

Tau interactome maps synaptic and mitochondrial processes associated with neurodegeneration.

Authors - Tara E Tracy
humanWB

Cell Discov

The Fe-S cluster assembly protein IscU2 increases α-ketoglutarate catabolism and DNA 5mC to promote tumor growth

Authors - Xiaojun Ren
humanWB

Cell Metab

Quantitative high-confidence human mitochondrial proteome and its dynamics in cellular context.

Authors - Marcel Morgenstern
  • KD Validated
monkeyWB,IF

Nat Cell Biol

MIROs and DRP1 drive mitochondrial-derived vesicle biogenesis and promote quality control.

Authors - Tim König

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Emilie (Verified Customer) (09-24-2025)

I applied it in IF (1:200), and it showed good performance.

  • Applications: Immunofluorescence
  • Cell Tissue Type: Fibroblasts
FH

Manon (Verified Customer) (09-17-2025)

We observed clear mitochondrial labeling with this antibody

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1/200
  • Cell Tissue Type: Fibroblasts
FH

Yan (Verified Customer) (10-21-2024)

Very good protein signal in BJ-hTERT cells in IF. I would recommend it to assess mitochondrial morphology.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: BJ-hTERT
TOMM40 Antibody Immunofluorescence validation (1:1000 dilution) in BJ-hTERT (Cat no:18409-1-AP)
FH

Nuo (Verified Customer) (01-28-2023)

Good antibody for WB with high titer.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: mouse cortex lysate
TOMM40 Antibody Western Blot validation (1:2000 dilution) in mouse cortex lysate (Cat no:18409-1-AP)
FH

Süleyman (Verified Customer) (01-23-2022)

TOMM40 antibody (Green) is used 1:100 dilution (2 hour at RT) and 1:700 of Alexa Fluor 488 secondary antibody (1 hour RT). 4% Paraformaldehyde fixation for 10 min at RT. Permeabilization with 0.3% Triton X for 10-15 minutes at RT. 5% FBS in PBS used for blocking for 1 hour at RT. The image is colocalized with TOMM20 (Red). Blue is DAPI. As you can see there is colocalization with TOMM20 with TOMM40. It is a perfect colocalization. You might also reduce concentration to 1:300 as it was used low power of laser.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: HeLa FlipIn
TOMM40 Antibody Immunofluorescence validation (1:100 dilution) in HeLa FlipIn (Cat no:18409-1-AP)
FH

Tom (Verified Customer) (03-23-2021)

Cos7 cells fixed in 4% PFA and permeabilized in 0.1% Triton X-100. Cells blocked in 1% BSA in PBS.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: Cos7
TOMM40 Antibody Immunofluorescence validation (1:200 dilution) in Cos7 (Cat no:18409-1-AP)
FH

Daniela (Verified Customer) (01-08-2020)

Immunoblot of total cell lysate of HeLa cell gives three bands, one specific for human Tom40 above 37 KDa on 15% acrylamide gel, the other two no specific and with much lower intensity. The anti-Tom40 antibody worked very well and specifically when conjugated with magnetic beads for immunoprecipitation.

  • Applications: Western Blot, Immunoprecipitation, Cell culture,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HeLa cells
Loading...
||
New chat Able
正在加载,请稍候...