TORC1/CRTC1 Recombinant monoclonal antibody, PBS Only

TORC1/CRTC1 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 86226-3-PBS
Clone No.250870G10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

CRTC1, CREB-regulated transcription coactivator 1, KIAA0616, MECT1, TORC 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86226-3-PBS targets TORC1/CRTC1 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0693

Product name: Recombinant human TORC1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-300 aa of BC028050

Sequence: MATSNNPRKFSEKIALHNQKQAEETAAFEEVMKDLSLTRAARLQLQKSQYLQLGPSRGQYYGGSLPNVNQIGSGTMDLPFQTPFQSSGLDTSRTTRHHGLVDRVYRERGRLGSPHRRPLSVDKHGRQADSCPYGTMYLSPPADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTGSRPKSCEVPGINIFPSADQENTTALIPATHNTGGSLPDLTNIHFPSPLPTPLDPEEPTFPALSSSSSTGNLAANLTHLGIGGAGQGMSTP

Predict reactive species
Full Name CREB regulated transcription coactivator 1
Calculated Molecular Weight 75 kDa
Observed Molecular Weight 68-80 kDa
GenBank Accession NumberBC028050
Gene Symbol CRTC1
Gene ID (NCBI) 23373
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ6UUV9
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CRTC1, also named as MECT1,TORC1, and WAMTP1, belongs to the TORC family. It is a transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. CRTC1 acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. It enhances the interaction of CREB1 with TAF4. CRTC1 regulates the expression of specific CREB-activated genes such as the steroidogenic gene, StAR. It is a potent coactivator of PGC1alpha and inducer of mitochondrial biogenesis in muscle cells. CRTC1 is also a coactivator for TAX activation of the human T-cell leukemia virus type 1 (HTLV-1) long terminal repeats (LTR). In the hippocampus, CRTC1 involved in late-phase long-term potentiation (L-LTP) maintenance at the Schaffer collateral-CA1 synapses. It may be required for dendritic growth of developing cortical neurons. CRTC1 has some isoforms produced by alternative splicing with MW of 67 kDa, 68 kDa and 62 kDa. Sometimes it appears as a 75-80 kDa band probably due to phosphorylation (PMID: 17183642; 22770221)

Loading...
||
New chat Able
正在加载,请稍候...