TPD52 Polyclonal antibody

• 

  WB analysis using 27648-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27648-1-AP (TPD52 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27648-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27648-1-AP (TPD52 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach cancer using 27648-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 27648-1-AP (TPD52 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 27648-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 27648-1-AP (TPD52 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TPD52 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27648-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, IHC, ELISA

Synonyms

D52, hD52, N8L, PC 1, PrLZ, Protein N8, TPD52, tumor protein D52

---

Tested Applications

• Positive WB detected in: L02 cells, HepG2 cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27648-1-AP targets TPD52 in WB, IHC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26503

  Product name: Recombinant human TPD52 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 57-184 aa of BC018117

  Sequence: LAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL

• Full Name: tumor protein D52
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 23-27 kDa
• GenBank Accession Number: BC018117
• Gene Symbol: TPD52
• Gene ID (NCBI): 7163
• RRID: AB_3085979
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P55327
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.