TPPP2 Polyclonal antibody, PBS Only

• 

  WB analysis using 13633-1-AP (same clone as 13633-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13633-1-AP (TPPP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13633-1-PBS in a different storage buffer formulation.

TPPP2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13633-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

13633-1-PBS targets TPPP2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4561

  Product name: Recombinant human TPPP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-170 aa of BC038970

  Sequence: MASEAEKTFHRFAAFGESSSSGTEMNNKNFSKLCKDCGIMDGKTVTSTDVDIVFSKVKAKNARTITFQQFKEAVKELGQKRFKGKSPDEVLENIYGLMEGKDPATTGATKATTVGAVDRLTDTSKYTGTHKELFDESGKGKGIAGREEMTDNTGYVSGYKGSGTYDKKTK

• Full Name: tubulin polymerization-promoting protein family member 2
• Calculated Molecular Weight: 170 aa, 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC038970
• Gene Symbol: TPPP2
• Gene ID (NCBI): 122664
• RRID: AB_10640435
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P59282
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.