TPRG1L Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83989-4-RR (same clone as 83989-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83989-4-RR (TPRG1L antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83989-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 83989-4-RR (same clone as 83989-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 83989-4-RR (TPRG1L antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83989-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 83989-4-RR (same clone as 83989-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 83989-4-RR (TPRG1L antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83989-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83989-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83989-4-RR against Human TPRG1L were performed. The affinity constant is 0.234 nM.

TPRG1L Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 83989-4-PBS

Clone No.241070G6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

241070G6, FAM79A, h mover, Mossy fiber terminal-associated vertebrate-specific presynaptic protein, MOVER

---

Product Information

83989-4-PBS targets TPRG1L in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag22585

  Product name: Recombinant human TPRG1L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-117 aa of BC019034

  Sequence: MLQLRDSVDSAGTSPTAVLAAGEEVGAGGGPGGGRPGAGTPLRQTLWPLSIHDPTRRARVKEYFVFRPGSIEQAVEEIRVVVRPVEDGEIQGVWLLTEREGFGIRIQWDKQSRPSFI

• Full Name: tumor protein p63 regulated 1-like
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC019034
• Gene Symbol: TPRG1L
• Gene ID (NCBI): 127262
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q5T0D9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TPRG1L (Tumor protein p63-regulated gene 1-like protein) belongs to the presynaptic protein involved in the synaptic transmission tuning. It can regulate synaptic release probability by decreasing the calcium sensitivity of release. TPRG1L has two isoforms with molecular weights of 30kd and 23kd respectively. This antibody can recognize the 30kd isoform and may also recognize the 23kd isoform.