Product Information
83989-4-PBS targets TPRG1L in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag22585 Product name: Recombinant human TPRG1L protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-117 aa of BC019034 Sequence: MLQLRDSVDSAGTSPTAVLAAGEEVGAGGGPGGGRPGAGTPLRQTLWPLSIHDPTRRARVKEYFVFRPGSIEQAVEEIRVVVRPVEDGEIQGVWLLTEREGFGIRIQWDKQSRPSFI Predict reactive species |
| Full Name | tumor protein p63 regulated 1-like |
| Observed Molecular Weight | 31 kDa |
| GenBank Accession Number | BC019034 |
| Gene Symbol | TPRG1L |
| Gene ID (NCBI) | 127262 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q5T0D9 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
TPRG1L (Tumor protein p63-regulated gene 1-like protein) belongs to the presynaptic protein involved in the synaptic transmission tuning. It can regulate synaptic release probability by decreasing the calcium sensitivity of release. TPRG1L has two isoforms with molecular weights of 30kd and 23kd respectively. This antibody can recognize the 30kd isoform and may also recognize the 23kd isoform.







