TPSB2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TPSB2 Polyclonal antibody (15332-1-AP)

• 

  WB analysis using 15332-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15332-1-AP (TPSB2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. TPSB2 deficient cell line K-562 served as a negative control.

TPSB2 Polyclonal Antibody for WB, ELISA

Cat No. 15332-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

EC:3.4.21.59, TPS2, Tryptase 2, tryptase beta 2, Tryptase beta-2

---

Tested Applications

• Positive WB detected in: mouse skin tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15332-1-AP targets TPSB2 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7335

  Product name: Recombinant human TPSB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 33-282 aa of BC065923

  Sequence: LQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP

• Full Name: tryptase beta 2
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC065923
• Gene Symbol: TPSB2
• Gene ID (NCBI): 64499
• RRID: AB_3741861
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P20231
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Tryptase beta-2 (TPSB2), also known as TPS2, is a member of the peptidase S1 family and the mast cell-specific tryptase subfamily. It is a serine protease primarily expressed in mast cells and basophils. TPSB2 is synthesized as a proenzyme, stored in secretory granules, and released upon cell activation. It plays a crucial role in allergic reactions and inflammation by cleaving extracellular matrix proteins, activating protease-activated receptors (PARs), and processing cytokines like IL-33. Elevated levels of TPSB2 are associated with conditions such as asthma, allergic rhinitis, and anaphylaxis, making it a biomarker and therapeutic target in these areas.