TRAF3 Monoclonal antibody

• 

  WB analysis using 66310-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66310-1-Ig (TRAF3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 66310-1-Ig

  WB result of TRAF3 antibody (66310-1-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TRAF3 transfected HEK-293 cells.

• 

  WB analysis using 66310-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66310-1-Ig (TRAF3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of U-937 using 66310-1-Ig

  LPS treated U-937 cells were subjected to SDS PAGE followed by western blot with 66310-1-Ig (TRAF3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lymphoma using 66310-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66310-1-Ig (TRAF3 antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 66310-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66310-1-Ig (TRAF3 antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 66310-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using TRAF3 antibody (66310-1-Ig, Clone: 1E3F4 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• Featured Product
• KD/KO Validated

TRAF3 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66310-1-Ig

Clone No.1E3F4

Publications(18)

Host / Isotype

Mouse / IgG2a

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

CD40 receptor-associated factor 1, CD40 binding protein, CAP-1, CAP1, CAP 1

---

Tested Applications

• Positive WB detected in: A549 cells, LPS treated U-937 cells, HEK-293 cells, Raji cells, Jurkat cells, NCI-H1299 cells
• Positive IHC detected in: human lymphoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 13 publications below
• IHC: See 1 publications below
• IF: See 3 publications below
• IP: See 3 publications below
• CoIP: See 1 publications below

Product Information

66310-1-Ig targets TRAF3 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12185

  Product name: Recombinant human TRAF3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 6-351 aa of BC075087

  Sequence: KMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMK

• Full Name: TNF receptor-associated factor 3
• Calculated Molecular Weight: 568 aa, 64 kDa
• Observed Molecular Weight: 64 kDa
• GenBank Accession Number: BC075087
• Gene Symbol: TRAF3
• Gene ID (NCBI): 7187
• RRID: AB_2881692
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13114
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TNF receptor-associated factor 3 (TRAF3) has many alternative names including CAP-1, CD40 receptor-associated factor 1(CRAF1), CD40-binding protein(CD40BP) and LMP1-associated protein 1 (LAP1). TRAF3 regulates pathways leading to the activation of NF-kappa-B and MAP kinases, and plays a central role in the regulation of innate immune response. It modulates signaling pathways leading to the production of cytokines and interferon. As an essential constituent of several E3 ubiquitin-protein ligase complexes, TRAF3 promote 'Lys-63'-linked ubiquitination of target proteins. Moreover, TRAF3 undergoes both 'Lys-48'-linked and 'Lys-63'-linked ubiquitination in response to various stimuli and is deubiquitinated by OTUB1, OTUB2 and OTUD5.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Am J Obstet Gynecol; microRNA-322 overexpression reduces neural tube defects in diabetic pregnancies; Authors - Guanglei Wang
human	WB	Clin Transl Med; Hypoxic colorectal cancer-derived extracellular vesicles deliver microRNA-361-3p to facilitate cell proliferation by targeting TRAF3 via the noncanonical NF-κB pathways.; Authors - Jie Li
human,mouse	WB,IP	mBio; ASB3 expression aggravates inflammatory bowel disease by targeting TRAF6 protein stability and affecting the intestinal microbiota; Authors - Mingyang Cheng
mouse	IHC	Free Radic Biol Med; Virtual screening identified natural Keap1-Nrf2 PPI inhibitor alleviates inflammatory osteoporosis through Nrf2-mir214-Traf3 axis.; Authors - Jianqiao Hong
human	WB	Front Immunol; Swine Acute Diarrhea Syndrome Coronavirus Nucleocapsid Protein Antagonizes Interferon-β Production via Blocking the Interaction Between TRAF3 and TBK1.; Authors - Zhihai Zhou
mouse	WB	Bioorg Chem; Synthesis and anti-inflammatory activity of paeonol derivatives with etherized aryl urea by regulating TLR4/MyD88 signaling pathway in RAW264.7 cell.; Authors - Xiaobao Gong